close all open/close all

CDS information : Teicp_00020


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction2,572 / 1,820 / - [in whole cluster]
2,572 / 1,820 / - [in contig]
Locationcomplement(1820..2572) [in whole cluster]
complement(1820..2572) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF10
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZK6
NITE
Teicp2_00080
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
MSATQEPGTSSRRRGGAGPVDDATVRAALIQAAERQLTASPDGDIATRAVSEEAGVTQPV
LYRLFGDKRGLLDAVADAGFDRYARRKSELEVTDNPVGDLYAGWDDHMAFATENPALYQL
MFAPRPRSGATTYRRILTLLEATLLRCAAAGALTTTPRAAAQLILSANIGVALGRIAAPE
LFDDPALSHRARDAAFATVLTHPATPSGPDPLRDAARQLRSQLSLSGTDRLEPAETVLLD
RWLERIDQPE
selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
ATGAGTGCTACGCAGGAGCCCGGCACGTCCTCCCGGCGGCGTGGCGGTGCGGGGCCCGTC
GACGACGCCACCGTCCGCGCCGCCCTGATCCAGGCCGCCGAGCGGCAGCTGACCGCCTCC
CCGGACGGCGACATCGCCACCCGCGCCGTCAGCGAGGAGGCCGGCGTCACCCAGCCGGTG
CTGTACCGGCTGTTCGGTGACAAACGCGGCCTGCTGGACGCCGTCGCCGACGCCGGATTC
GACCGCTACGCCCGGCGCAAGAGCGAACTGGAGGTCACCGACAACCCGGTCGGCGACCTG
TACGCGGGATGGGACGACCACATGGCGTTCGCCACCGAGAACCCGGCCCTCTACCAGCTG
ATGTTCGCGCCCCGGCCGCGTTCGGGCGCGACCACCTACCGCCGCATCCTGACACTGCTC
GAGGCCACCCTCCTGCGCTGCGCCGCCGCCGGCGCGCTCACCACGACGCCCCGGGCAGCC
GCCCAGCTGATCCTGAGCGCCAACATCGGCGTCGCTCTCGGCCGCATCGCCGCGCCGGAG
CTCTTCGACGACCCGGCGCTGTCGCACCGCGCCCGCGACGCCGCCTTCGCCACCGTGCTC
ACCCACCCCGCCACGCCGAGCGGGCCGGACCCGCTCCGCGACGCCGCCCGCCAGCTGCGC
TCGCAGCTCTCGCTCAGCGGCACCGACCGGCTGGAACCGGCCGAGACCGTGCTGCTCGAC
CGGTGGCTGGAGCGCATCGACCAGCCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [23-83]  PS50977
PS50977   HTH_TETR_2
 [29-75]  1.6e-07 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [21-99]  3.00000067992871e-11 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [95-202]  3.69999844802221e-06 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [23-214]  3.60000000000001e-25 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [107-172]  5.3e-07 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit