close all open/close all

CDS information : Teicp_00030


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction2,684 / 3,418 / + [in whole cluster]
2,684 / 3,418 / + [in contig]
Location2684..3418 [in whole cluster]
2684..3418 [in contig]
TypeCDS
Length735 bp (244 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)short chain dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF9
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZK5
NITE
Teicp2_00090
ACC
Q9ZGC1
NITE
Lando_00190
PmId
[16283688] LanV, a bifunctional enzyme: aromatase and ketoreductase during landomycin A biosynthesis. (Chembiochem. , 2005)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>putative oxidoreductase [short chain dehydrogenase]
MGDHRVAVVTGASRGIGRAVATALAGAGHAVVVGYAGNEAAAKEVVDRIAATGGRAVAAR
ADVADENAVAALFDTATEAFGGVDVVVNSAGRMALSPIADLDLADLDALHRTNIRGTFVV
AREAARRVRPGGAIVLVSTSILGLQFPGYGAYAASKGAVEAMTLILAREMRGRDITVNTV
APGPTATELFLEGKDEATVEHLAKQPPLERLGTPADIAGVVAFLAGPGGRWVNGQVLRAN
GGIV
selected fasta
>putative oxidoreductase [short chain dehydrogenase]
ATGGGTGATCACCGAGTCGCCGTCGTCACCGGGGCTTCGCGTGGCATCGGCCGTGCCGTC
GCCACCGCGCTGGCCGGCGCCGGGCACGCCGTCGTCGTCGGCTACGCCGGCAATGAGGCG
GCCGCGAAGGAGGTCGTCGACCGGATCGCCGCCACCGGTGGCCGGGCCGTCGCCGCCCGG
GCCGACGTCGCCGACGAGAACGCGGTCGCCGCTCTGTTCGACACCGCCACCGAGGCCTTC
GGCGGGGTCGACGTCGTGGTCAACTCGGCCGGCCGGATGGCCCTGTCCCCGATCGCCGAC
CTCGATCTGGCCGACCTGGACGCCCTGCACCGCACCAACATCCGCGGCACGTTCGTCGTC
GCCCGCGAGGCCGCCCGCCGGGTCCGCCCGGGCGGCGCGATCGTGCTGGTGTCCACCTCG
ATCCTCGGCCTGCAGTTCCCCGGCTACGGCGCGTACGCCGCCAGCAAGGGGGCCGTCGAG
GCGATGACGCTGATCCTGGCGCGGGAGATGCGCGGCCGGGACATCACGGTCAACACCGTC
GCGCCCGGCCCCACCGCCACCGAGCTGTTCCTGGAGGGCAAGGACGAGGCGACCGTCGAG
CACCTGGCCAAGCAGCCGCCGCTGGAGCGGCTCGGCACCCCGGCCGACATCGCCGGGGTC
GTCGCCTTCCTCGCCGGGCCGGGCGGGCGCTGGGTCAACGGCCAGGTGCTCCGGGCCAAC
GGCGGCATCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [81-92]  1.30000067202732e-07 PR00080 [132-140]  1.30000067202732e-07 PR00080 [152-171]  1.30000067202732e-07 PR00080
PR00080   SDRFAMILY
 [6-169]  9.29999999999998e-33 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [6-23]  1.3000049540733e-33 PR00081 [81-92]  1.3000049540733e-33 PR00081 [152-171]  1.3000049540733e-33 PR00081 [173-190]  1.3000049540733e-33 PR00081 [207-227]  1.3000049540733e-33 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-243]  7.99999999999993e-74 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit