close all open/close all

CDS information : Teicp_00070


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction7,682 / 8,290 / + [in whole cluster]
7,682 / 8,290 / + [in contig]
Location7682..8290 [in whole cluster]
7682..8290 [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative D-alanyl-D-alanine dipeptidase
Product (GenBank)dipeptidase
GenevanX
Gene (GenBank)
EC number3.4.13.22
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZK1
NITE
Teicp2_00130
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)
[17220405] Resistance to glycopeptide antibiotics in the teicoplanin producer is mediated by van gene homologue expression directing the synthesis of a modified cell wall peptidoglycan. (Antimicrob Agents Chemother. , 2007)
ACC
Q9ZI81
NITE
A4793_00330
PmId
[9751644] Homologs of the vancomycin resistance D-Ala-D-Ala dipeptidase VanX in Streptomyces toyocaensis, Escherichia coli and Synechocystis: attributes of catalytic efficiency, stereoselectivity and regulation with implications for function. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative D-alanyl-D-alanine dipeptidase [dipeptidase]
MKDDFAFVDELVPGIRWDAKYATWDNFTGKPVDGYVANRIVGTKALCAALARAQEEAETL
GFGLLLWDGYRPQRAVDCFMRWAEQPEDGRKKLRHYPNIGRPEMFEKGYVATKSGHSRGS
TVDLTLYNLATGELASMGGDHDLMDPISHHGASGITPIEAKNREYLCSIMEGCGFARYDY
EWWHYTLKNEPYPDTYFDFPIV
selected fasta
>putative D-alanyl-D-alanine dipeptidase [dipeptidase]
ATGAAAGACGACTTCGCGTTCGTGGACGAGCTCGTGCCAGGCATACGCTGGGATGCCAAG
TACGCCACCTGGGACAATTTCACCGGCAAGCCGGTGGACGGTTACGTTGCGAATCGGATC
GTCGGAACGAAGGCGTTGTGCGCTGCCCTGGCGCGCGCCCAGGAAGAGGCCGAGACGCTT
GGCTTCGGTCTGCTTCTCTGGGATGGGTATCGGCCGCAACGCGCCGTGGACTGCTTCATG
CGCTGGGCGGAGCAGCCGGAGGACGGCCGCAAGAAGCTGCGGCACTACCCGAACATCGGC
AGGCCCGAGATGTTCGAGAAGGGGTATGTCGCCACCAAGTCCGGTCACAGCCGCGGCAGC
ACCGTCGACTTGACGCTCTACAACCTTGCCACCGGCGAACTGGCGTCGATGGGCGGCGAC
CACGACCTGATGGATCCGATCTCCCACCACGGGGCCAGCGGAATCACGCCGATCGAAGCG
AAGAACCGTGAATACCTCTGCTCGATCATGGAGGGCTGCGGATTCGCCAGGTACGACTAC
GAGTGGTGGCACTACACCCTGAAGAACGAACCCTATCCCGACACATATTTTGATTTTCCG
ATCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000755 Peptidase M15D, VanX D-ala-D-ala dipeptidase (Family)
 [1-202]  4.30000170645869e-58 PIRSF026671
PIRSF026671   AA_dipeptidase
 [3-200]  2.09999999999996e-68 PF01427
PF01427   Peptidase_M15
IPR009045 Hedgehog signalling/DD-peptidase zinc-binding domain (Domain)
 [1-202]  1.09999184471405e-71 SSF55166
SSF55166   Hedgehog_sig_N
 [2-201]  1.69999999999998e-65 G3DSA:3.30.1380.10
G3DSA:3.30.1380.10   Hedgehog/DD-pept_Zn-bd
SignalP No significant hit
TMHMM No significant hit