close all open/close all

CDS information : Teicp_00130


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction20,242 / 23,427 / + [in whole cluster]
20,242 / 23,427 / + [in contig]
Location20242..23427 [in whole cluster]
20242..23427 [in contig]
TypeCDS
Length3,186 bp (1,061 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase, module 3
Gene
Gene (GenBank)teiB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AZ8
NITE
Teicp2_00190
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)

close this sectionPKS/NRPS Module

A3 L-3,5-dihydroxyphenylglycine(Dpg)
C14..309
A488..878
PCP954..1020

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 3]
MTTPTTSPGSALAEVWPLSPMQEGMLYHASFDDAAPDIYVIQQSQIIDGPLDTERFRRSW
EVLLHRHAALRASFHRRKSGETVQLIPREVRLPWAERDLSGLPEKAALAEVGEIAAKERA
ERFDLTKPPLLRLMLIRLGPQRHCLVTTSHHLLMDGWSRAILESELLHVYASGGTVSGLP
PAGSYRHYLSWLGRQDREAARSAWRAELSGADGSALGIAERPGKAPELPAREVLRHSPEF
TSALVDFARRHGLTLNTLVQGAWAVVLARLARRTDVVFGATVSGRPAELPGVEQLVGLFI
NTVPVRVRLDAGQPVLEMLTELQKRQSALISHQHLGLPEIQKLGGASFDTIVVFENYVDP
AAAPDSPRGLRLTLREFHQASPYAITLGVMPGESLETDVQYPPETLDARIAEEALYGLAR
VLEQIIAEPGAAVGRLDVVSAAGRQLTVERWNETGDAVDAPSPVDLFRRQVRRAPDATAV
TAGDRAWSFKELDEWSGRLARALTDRGVRRGDRVGVMLERSAEVLAAWLGVWKAGAAFVP
VDPGYPADRVEFMLADSAVAAVLCRESTAGAVPAGHELIDMDRVGEGVAAPVAIGADDLA
YVMYTSGSTGKPKGVAVAHGGVAALAGDPVWEVGARDAVLMHAPHTFDASLYDVWVPLVS
GARVMLAEPGVVDAQRLAAHVADGLTAVNFTAGQFRALAQESPESFAGLRDVLAGGDVVP
LGAVERVRQACPGLRVWHTYGPTETTLCATWKKIEPGDRLGSTLPIGRPLPGRRLYVLDV
FLRPLPPGVAGDLYIAGAGVAQGYLGRPALTAERFVADPFAAGERMYRTGDVAYWTGDGE
LVFAGRADNQVKIRGYRVEPGEIETVLAEQPGVDQAVVLARDGRLIGYVVPGGEVDPVRL
RERVARVLPEYMVPAAVMVLDALPVTPNGKLDREALPDPDFSRRVSGREPRTGVERALCG
LFAEVLGLERVGVDDSFFELGGDSITSMQLAARARRDGMAFGAREVFQHRTPAGIAAIVD
SGNEPAAGGDGEATWTPVRRFGLVDLDQQEVEELESEFGDR
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 3]
GTGACAACTCCGACTACGTCCCCAGGATCGGCGCTCGCGGAGGTCTGGCCGCTGTCACCG
ATGCAGGAGGGGATGCTCTACCATGCCTCGTTCGACGACGCGGCCCCCGACATCTACGTC
ATCCAGCAATCGCAGATCATCGACGGCCCTCTGGACACCGAGCGATTCCGGAGGTCCTGG
GAGGTCCTTCTCCACCGGCACGCGGCGCTGCGAGCGAGTTTCCACCGCCGGAAGTCCGGT
GAGACCGTCCAGCTGATCCCCCGTGAGGTCCGGCTTCCCTGGGCCGAACGTGACCTGTCC
GGCCTGCCCGAGAAGGCGGCGCTGGCCGAGGTGGGCGAGATCGCGGCGAAGGAGCGCGCC
GAAAGGTTCGACCTCACGAAGCCTCCCCTGCTGCGGTTGATGCTGATCCGCCTCGGCCCG
CAGCGGCACTGTCTGGTGACCACGAGCCATCACCTGCTCATGGACGGGTGGTCGCGGGCC
ATCCTGGAATCGGAGCTGCTCCATGTCTACGCGTCCGGTGGCACCGTCTCGGGGCTGCCG
CCCGCCGGCTCGTACCGTCACTATCTGTCATGGTTGGGTCGGCAGGACCGGGAGGCCGCC
CGATCGGCATGGCGCGCGGAGCTGTCCGGCGCCGACGGATCCGCGCTCGGAATCGCGGAG
CGGCCAGGGAAGGCTCCGGAGCTGCCGGCACGCGAGGTGCTCCGCCATTCACCGGAGTTC
ACGTCCGCTCTCGTGGACTTCGCCCGCCGCCACGGGTTGACGCTCAACACGCTGGTGCAG
GGCGCCTGGGCGGTGGTGCTGGCCCGATTGGCGCGCCGCACGGACGTGGTGTTCGGCGCG
ACGGTGTCGGGACGCCCCGCGGAGCTGCCCGGCGTGGAACAGCTTGTGGGCCTGTTCATC
AACACCGTGCCGGTGCGAGTCCGGCTGGACGCCGGGCAGCCGGTCCTGGAGATGTTGACG
GAGCTGCAGAAACGGCAGTCCGCGCTGATCTCGCATCAGCATCTCGGATTGCCGGAGATC
CAGAAGCTCGGCGGGGCGAGTTTCGACACGATCGTCGTCTTCGAAAACTATGTCGATCCG
GCCGCGGCGCCGGATTCTCCGCGCGGCCTGCGCCTGACCCTGCGAGAGTTCCACCAGGCG
TCGCCGTATGCGATCACGCTGGGAGTGATGCCGGGCGAGAGCCTCGAGACCGACGTGCAG
TATCCCCCGGAGACGCTCGATGCCCGGATCGCCGAGGAAGCCCTGTACGGGCTGGCCCGC
GTCCTGGAACAGATCATCGCCGAGCCGGGAGCGGCGGTGGGCCGCCTCGACGTGGTGAGT
GCGGCCGGCCGGCAGCTGACCGTCGAGCGGTGGAACGAGACCGGCGACGCGGTGGACGCG
CCGTCCCCGGTCGATCTCTTCCGCCGGCAGGTGCGGCGGGCACCCGACGCGACGGCCGTG
ACGGCCGGGGACCGGGCCTGGTCGTTCAAGGAGCTCGACGAATGGTCCGGCCGGCTGGCG
CGGGCCCTGACGGATCGGGGTGTCCGGCGCGGCGACCGGGTCGGGGTGATGCTGGAGCGG
TCGGCCGAGGTGCTGGCGGCATGGCTCGGGGTGTGGAAGGCGGGAGCCGCGTTCGTGCCG
GTCGATCCGGGCTACCCGGCGGACCGGGTGGAGTTCATGCTGGCCGACTCCGCGGTCGCG
GCGGTGCTGTGCCGGGAGTCGACCGCGGGTGCGGTGCCGGCGGGTCACGAGCTGATCGAC
ATGGACCGGGTCGGCGAGGGCGTGGCCGCGCCGGTCGCGATCGGAGCCGACGATCTGGCG
TACGTCATGTACACGTCCGGATCCACCGGCAAGCCCAAGGGCGTGGCCGTCGCGCACGGG
GGTGTGGCGGCATTGGCCGGTGATCCGGTCTGGGAGGTGGGGGCCCGCGACGCGGTGCTG
ATGCACGCTCCGCACACCTTCGACGCGTCGCTCTACGACGTGTGGGTGCCGCTGGTCTCC
GGCGCGCGGGTGATGCTCGCCGAGCCGGGCGTGGTCGACGCGCAGCGGCTCGCCGCACAC
GTGGCGGATGGTCTCACCGCGGTGAACTTCACCGCCGGTCAGTTCCGGGCGCTGGCACAG
GAGTCGCCGGAATCCTTCGCCGGACTGCGCGACGTGCTCGCGGGTGGAGACGTGGTGCCG
CTCGGCGCGGTGGAGCGGGTCCGGCAGGCGTGCCCCGGGCTACGGGTCTGGCACACGTAC
GGCCCGACGGAGACCACGCTGTGCGCGACGTGGAAGAAGATCGAGCCGGGTGACCGGCTG
GGCTCGACGCTGCCGATCGGCCGGCCGCTGCCGGGCCGTCGGCTGTACGTGCTGGACGTC
TTCCTGCGTCCGCTGCCGCCGGGCGTCGCGGGTGATCTCTACATCGCGGGCGCCGGCGTG
GCCCAGGGCTACCTCGGGCGTCCGGCGCTGACCGCCGAGCGGTTCGTCGCCGACCCGTTC
GCCGCGGGCGAGCGGATGTACCGGACCGGGGACGTGGCGTACTGGACCGGTGACGGCGAG
CTGGTGTTCGCCGGGCGCGCCGACAACCAGGTCAAGATCCGTGGCTATCGGGTGGAACCG
GGCGAGATCGAGACGGTGCTGGCCGAGCAGCCGGGCGTCGACCAGGCGGTGGTGCTGGCC
CGCGACGGCCGTTTGATCGGCTACGTGGTGCCCGGCGGCGAGGTGGATCCGGTACGGCTG
CGCGAGCGGGTCGCCCGGGTGTTGCCGGAGTACATGGTCCCGGCGGCGGTGATGGTCCTG
GACGCCCTGCCGGTGACTCCGAACGGGAAGCTGGACCGGGAGGCTCTGCCGGATCCGGAC
TTCAGCCGACGCGTCTCCGGCCGGGAGCCGCGTACCGGGGTCGAGCGGGCGCTGTGCGGT
CTCTTCGCCGAGGTGCTGGGTCTGGAACGGGTCGGGGTCGACGACAGCTTCTTCGAACTC
GGCGGAGATTCGATCACCTCGATGCAGCTCGCCGCACGCGCCCGCCGCGACGGGATGGCC
TTCGGCGCGCGAGAGGTGTTCCAGCACCGGACGCCGGCCGGGATCGCGGCGATCGTCGAT
TCCGGGAACGAGCCGGCGGCCGGTGGCGACGGCGAGGCGACGTGGACGCCGGTGCGGCGG
TTCGGCCTCGTCGACCTGGACCAGCAGGAGGTCGAAGAACTCGAGTCCGAGTTCGGCGAC
CGTTGA
[3] C14..309
[3] A488..878
[3] L-3,5-dihydroxyphenylglycine(Dpg)648..748
[3] PCP954..1020
[3] C40..927
[3] A1462..2634
[3] L-3,5-dihydroxyphenylglycine(Dpg)1942..2244
[3] PCP2860..3060

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [488-878]  1.10000000000001e-108 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [14-309]  1.70000000000001e-59 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [979-994]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1017]  7.79999999999999e-13 PF00550
PF00550   PP-binding
 [954-1020]  PS50075
PS50075   ACP_DOMAIN
 [946-1022]  2.7e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [947-1021]  2.49999811956465e-19 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [488-878]  7.09999999999991e-128 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020459 AMP-binding (Domain)
 [597-608]  4.69999810630989e-05 PR00154 [609-617]  4.69999810630989e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [602-613]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit