close all open/close all

CDS information : Teicp_00140


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction23,471 / 35,674 / + [in whole cluster]
23,471 / 35,674 / + [in contig]
Location23471..35674 [in whole cluster]
23471..35674 [in contig]
TypeCDS
Length12,204 bp (4,067 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase, module 4-6
Gene
Gene (GenBank)teiC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AZ7
NITE
Teicp2_00200
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 tyrosine
C7..301
A481..876
PCP954..1020
E1060..1496
C1506..1797
A1978..2372
PCP2455..2521
E2555..3007
C3019..3307
A3490..3877
PCP3964..4030

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 4-6]
MTQARIEDIWPLSPLQEGLLFHTVYDDEGPDVYVGHWILDLDGPVDAARLRAAWEALLAR
HAALRACFRQRRTGETVQVVAGRVELPWRVVDLAHLDDPEHAVRELADEDRLRPFDVAKP
PLLRLTLIRLADDRHRLVVTCHHAVMDGWSLPIVFDELTALYAAGDGPAQLPAVTPYREY
LAWLSRQDKPSALAAWAAELRGAQEPTLVAPADPGRAPGMPESVEVQLSPELTRSLAELA
RGRGLTLNTVIQGAWALVLARLTGRTDVVFGATVSARPAHLPGVEAMVGLFLNTVPVRVR
LRGSAPVVEMLAELQKRQSALIPEQFVGLADIQKAAGPGAVFDTLLVFENFPRELDDSRS
ADAFGIRVHQGREAAHYPLTLVAVPGESMLFKLDYLTELFDAATAASILERFTRVLRRLT
DAGELTVAAIDVTSAAERDRVARWGAAVGARPDRLALDLFARQVAQRPDEVAVADGDRVM
SFGELAERADRLAGHLSARGVRRGDRVAVVMERSGELIATLLAVWRAGAAFVPVDPAYPA
ERVKFLLTDAEPVAAVCTAAFRAAVLDGGLEAIVVDDPGTWPAVAPCPPVPTGPDDLAYV
MYTSGSTGTPKGVAVSHGDVAALVGDPGWRTGPGDTVLMHASHAFDISLFEIWVPLLSGA
RVMIAGPGAVDGAALAAQVAAGVTAAHLTAGAFRVLAEESPESVAGLREVLTGGDAVPLA
AVERVRRACPDVRVRHLYGPTETTLCATWWLLEPGDETGPVLPIGRPLAGRRVYVLDAFL
RPLPPGTTGELYVAGAGVAQGYLGRPALTAERFVADPFAPGGRMYRTGDLAYWTEQGTLA
FAGRADDQVKIRGYRVEPGEVEAVLGGLPGVAQAVVCVRGEHLIGYVVAEAGRDLDPERL
RARLAATLPEFMVPAAVLVLADLPLTVNGKVDRPALPEPDFAAKSTGRAPATAAERILCD
VFAGVLGLDRVGVEDSFFALGGDSISSMQVAARARREGIALTPRQVFEHRTPERLAALAP
AAGSARPDRSAADAGLGEIPWTPVMRALGDDAVRPGFAQARVVVAPAGLDPDALTGALRA
VLDTHDVLRARVEPDRRLIVPERGAVAAADLLTRVAVDSDGIDARAEREAATAAGTLDPS
AGIMLRAVWLDAGDAEPGRLALVAHHLVVDAVSWSILLPDLQAAYQEVLAGATPALEPAA
TSYRQWARRLTEQASSPSTLAELDHWVTVLDAAEPPLAEHHGQAHSWSATLSGAVAGHLV
SRMPGAFHCGIQEVLLAGLAAAVARWRGDDAGVLVDVEGHGRHAADGEDLLRTVGWFTSV
HPVRLDVSGVDLAAAAAGDAAAGELLKSVKDQVRAAPGDGFGFGLLRHLNPDTAERLAAL
PAPQIGFNYLGRSGVAAEAVPWQVRGGSLGAGEAGPDLVLAHPLEAGADVRDTPDGPLLR
LTLDGRDLAPVTVELLGEAWLELLTGLATHAGDPRAGGHTPADFDLVEVTQRDVTALEAA
APGLTDIWPLSPLQRGMLFERALDEDGVDVYQSQRILDLDGPLDADRLRAAWRTLVARHE
SLRTSFHQLESGETVQVVVDQADIGWRVADVSHRAEADAAAEVGRLLAEDQAQRFDVTRA
PLLRLLLVRLGADRHRLVVTSHHIVLDGWSTPIILGEMSAAYAGAPSTATAPSPRDYLAW
LNRQDDAATRAAWRSELAGCDEPTLVDADADKTMVMPGEHCEGLSEQATRRLTEFARGHA
VTLSTILQGAWALVLARLAGRTDVVFGTVVSGRPAEVPDVDRMVGMFINTVPVRVRLDGG
RPVLDLLHDLQARQSALTEHQHLGLPDIQRAAGPGALFDTIMMVENYPMDAAGLGGEGGV
RIGSVLTRTGTSYPLTMSASPGERLQIRVSYRPDRIERETAAEAAGQVVRVIERIVAEPS
LAVGRLGVTGESVRERVVERWNATGVAAGGSSVLTGFRRRARSSPDAVAVSGGGRTLSYA
ALDRESDRLAGHLAGRGVRRGDRVGVVMERGTDLFVALLAIGKAGAAYVPVNLDYPRDRI
ERMLTDAGVSVAVCVQATSGAVPDGLAPVVMDSPAIAAAPSEAPPITVGAHDLAYVMYTS
GSTGVPKGVAVPHGSVAALAGDPGWSVGPGDGVLMHAPHAFDASLLEIWVPLLSGAHVVV
ADPGAVDAQRLREAIDRGVTTVHLTAGSFRVLAEESPDAFRGLREVLTGGDAVPLASVVR
LRETCPEIRVRHLYGPTETTLCATWHLIEPGVATGDTLPIGRPLAGRRAYVLDAFLQPVA
PNVTGELYLAGAGLARGYLGAAAATAERFVADPFAAGERMYRTGDLARWTEQGELLFAGR
ADAQVKIRGYRVEPAEIEAALTAIPEVAQAVVVAREDGPGEKRLIAYVTAAGQPGPDPAA
VREHLGERLPEFMVPAAVVVLDGFPLTINGKIDRAALPAPERSGKPAGREPRTEVERVLC
DLFADLLGLDRVGADDSFFELGGDSIVSMQLAARARREGVVFGAKDVFEQKTPAAIAAVA
VRGGQRPAGPDDGVGEVAWTPVMRGLLDRDPGTMNRSAMAQWVTVGAPDTLSRDVLAAGL
GAVLDAHDMLRSRVVAAGTEEPRLVVAPRGAVHAAGLVDRVEAGAGEVDDLTERSAAEAA
TRLDPGAGVMVRAVWVDAGPGRVGRLVVVAHHLVVDAVSWRILLPDLRAACEAVAAGREP
ALDPVDVSFRRWARTLTDQAATRTAELATWTRILGGAQPRFGALDPGRDTISTAGRRTWT
VPQDRAGVLVERVTSAFHCGVHEVLLATLAGAVARWRGGAAVVVDVEGHGRRPLGEMDLS
RTVGWFTDVHPLRLDVTGIDTAEVIAGGGAAGRLLKTVKENVRAVPDGGLGYGMLRHLNA
ETGRVLAAQPAAEIGFNYLGRFSEGPGGDVQPWQQLGTIGGTAEPDMPLRHAVEIDAAVL
DAADGPRLELTVTWAGRLVGAAEAESLGRAWQDVLAGLAVHAGDVRAGGHTPSDFPLTAL
SGQEVAQIEAAVPDLLDIWPLSPLQEGLLFHAVDERGPDVYASMRTLAVDGPLDVARFRA
SWQAVLDRHAALRASFHQLESGAAVQAIAREVTLPWQETDLSDLPEDVALAEFDRLAAQL
RDERFDLTRAPLLRLHLVRLGERRHRLAFASHHISCDGWSLPIVSTEVMAAYEGRGLPAP
TSYRDYLVWLARQDKEAARQAWRGELAGLDEATHVVPPDTITAPIAPQRVRFGLDDELSR
RLVRFTRRHGVTMNTLFQGIWSLLLARLTGRDDVVFGSAVAGRPAEIPGVGSVVGLFMNT
APVRVRLDGAEPFLDMLTDLQRRQVAMMAHQHLGLSEIKQVAGPGAAFDTLVVFENYPRP
PRPSDDPDAVVMRPAEIPEDSGHYPVSMRASEDGGVHGEFIFRPDAFDRAEAEGMLAAII
EALRQVVAEPGIAVGRIGLVGAAERRQVVREWNETDAPLTAQPLPMLFRRQAQRSPDAVA
VRDAARSLSFGALLGEAEGLARRLVASGVRRGDPGGRALERSAELVVALLGVSLAGGVFV
PVDPDYPGDRIALMLADAAPQVLVCTARTRSVVPGDFAGAVLALDEPSAAGPQVSLPRVA
ARDGAYVIYTSGSTGVPKGVLVTHAGLGNLASAQIERFGVTSSSRVLQFAALGFDAAISE
VCMALLSGGSIVLADAEHMPPRVSLGDAVRRWDITHVTVPPSVLAVEDDLPDDLTLIVAG
EACPPALVDRWSPGRRMINGYGPTETTVCATMSSPLSPGRGAVPIGGPIANMRTYVLDAF
LQPVPPGMTGELYVTGVGLARGYLGRPGLTAERFVADPFSPGGRMYRTGDRARWTGDGEL
VFAGRVDAQVKVRGYRIEPGEIEAVLAEHPGVAQVVVVARQDGPGEKQLVAYVVPAAGPT
AEASTLISALREAAAARLPEHMVPAAFVPLDAMPLTPNGKVDHRALQAPDFAGMSAGRDP
RTALEAKLCELFAEVLGLEQVGADDSFFELGGDSITSMQLSTRARREGLELTPWQVFDEK
TPERLAALVKEIPADGGATGAPEPAAGTLVALSPEQMDQLEAGPAGE
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 4-6]
GTGACCCAGGCGCGCATCGAGGACATCTGGCCGCTGTCGCCGCTGCAGGAGGGACTGCTC
TTCCACACCGTCTACGACGACGAGGGGCCGGACGTCTACGTGGGCCACTGGATCCTCGAT
CTCGACGGCCCGGTGGACGCGGCCCGGCTGCGCGCGGCGTGGGAGGCGCTGCTGGCCCGG
CACGCCGCGCTGCGGGCCTGCTTCCGGCAGCGCCGGACCGGCGAGACCGTGCAGGTCGTC
GCCGGCCGGGTGGAGCTGCCGTGGCGGGTGGTCGACCTGGCCCACCTCGACGATCCCGAG
CACGCCGTGCGGGAACTGGCCGACGAGGACCGGCTGAGGCCCTTCGACGTCGCGAAGCCG
CCGCTGCTGCGGCTGACCCTGATCCGGCTCGCCGACGACCGGCACCGCCTGGTGGTGACC
TGCCATCACGCGGTCATGGACGGCTGGTCGTTGCCGATCGTCTTCGACGAGCTGACCGCG
TTGTACGCGGCCGGCGACGGCCCGGCACAGCTGCCGGCGGTGACGCCCTACCGGGAGTAC
CTCGCCTGGCTGAGCCGGCAGGACAAGCCGAGCGCGCTGGCGGCGTGGGCCGCGGAGCTG
CGTGGCGCGCAGGAGCCGACGTTGGTGGCCCCCGCCGATCCGGGACGGGCGCCGGGCATG
CCGGAGAGCGTCGAGGTGCAGCTGTCGCCGGAGCTCACCCGCTCGCTGGCGGAGCTGGCC
CGTGGCCGGGGGCTGACGCTGAACACGGTGATCCAGGGCGCCTGGGCGCTGGTGCTGGCG
CGGCTGACCGGCCGGACGGACGTGGTGTTCGGGGCGACGGTGTCGGCGCGTCCGGCGCAC
CTGCCCGGCGTGGAGGCAATGGTCGGCCTGTTCCTCAACACCGTGCCGGTGCGGGTACGG
CTGCGGGGTTCGGCGCCGGTCGTCGAGATGCTGGCGGAGCTGCAGAAGCGGCAGTCCGCT
CTCATCCCCGAACAGTTCGTCGGACTGGCGGACATCCAGAAGGCGGCCGGGCCCGGCGCG
GTCTTCGACACCCTGCTGGTCTTCGAGAACTTCCCCCGCGAGCTCGACGATTCGCGCTCG
GCCGACGCGTTCGGCATCCGGGTGCACCAGGGCCGCGAAGCCGCGCACTATCCACTGACG
CTGGTCGCGGTCCCCGGCGAGTCGATGCTGTTCAAGCTCGACTACCTGACGGAGCTGTTC
GACGCGGCCACCGCGGCGTCCATCCTGGAACGGTTCACCCGGGTCCTGCGCCGGCTGACG
GACGCGGGCGAGCTCACGGTGGCCGCGATCGACGTGACCAGCGCGGCGGAGCGCGACCGG
GTGGCGCGATGGGGCGCGGCCGTCGGTGCGCGGCCGGACCGGCTGGCGCTGGACCTGTTC
GCACGCCAGGTCGCGCAGCGCCCCGACGAGGTGGCGGTCGCCGATGGGGACCGGGTGATG
TCGTTCGGGGAGCTGGCCGAGCGCGCGGACCGGCTCGCCGGTCACCTCAGCGCGCGCGGG
GTCCGGCGCGGGGACCGGGTGGCCGTGGTGATGGAGCGGTCCGGCGAGCTGATCGCGACG
TTGCTCGCGGTGTGGCGGGCCGGGGCGGCGTTCGTACCGGTGGATCCGGCCTATCCCGCG
GAGCGGGTGAAGTTCCTGCTGACCGACGCGGAGCCGGTGGCGGCGGTGTGCACGGCCGCG
TTCCGGGCCGCCGTGCTGGACGGCGGGCTCGAGGCGATCGTGGTGGACGATCCGGGGACG
TGGCCGGCGGTGGCGCCGTGCCCGCCGGTCCCCACCGGACCCGACGACCTCGCCTACGTG
ATGTACACCTCGGGCTCGACCGGGACGCCCAAGGGCGTCGCGGTGTCGCACGGCGACGTC
GCGGCGCTGGTCGGCGACCCGGGATGGCGGACCGGTCCCGGCGACACCGTGCTGATGCAC
GCCTCGCACGCGTTCGACATCTCGCTGTTCGAGATCTGGGTGCCGCTGCTGTCCGGCGCC
CGGGTGATGATCGCCGGACCGGGCGCGGTGGACGGCGCGGCGCTGGCCGCTCAGGTGGCC
GCCGGGGTGACGGCCGCGCACCTGACCGCGGGCGCCTTCCGGGTGCTGGCCGAGGAGTCG
CCGGAGTCGGTCGCCGGGCTGCGCGAGGTGCTGACCGGCGGTGACGCGGTGCCGCTGGCG
GCGGTCGAACGGGTGCGGCGGGCGTGTCCGGACGTCCGGGTGCGGCACCTGTACGGCCCG
ACCGAGACCACCCTGTGCGCCACCTGGTGGCTGCTCGAACCGGGCGACGAGACCGGCCCG
GTGCTGCCGATCGGTCGCCCGCTCGCGGGCCGGCGCGTCTACGTCCTCGACGCGTTCCTG
CGGCCCCTGCCGCCCGGGACGACCGGCGAGCTGTACGTCGCCGGGGCCGGTGTGGCGCAG
GGCTACCTGGGCCGCCCGGCGCTGACCGCCGAGCGGTTCGTCGCCGACCCCTTCGCTCCC
GGTGGCCGGATGTACCGCACCGGCGACCTGGCGTACTGGACCGAGCAGGGCACGCTGGCG
TTCGCCGGACGGGCCGACGACCAGGTCAAGATCCGTGGCTACCGGGTGGAGCCCGGCGAG
GTCGAAGCGGTCCTGGGCGGCCTGCCGGGTGTCGCCCAGGCCGTGGTGTGCGTCCGCGGC
GAGCACCTGATCGGTTATGTGGTGGCCGAGGCCGGCCGGGACCTCGACCCGGAACGCCTG
CGCGCCCGGCTCGCCGCGACCCTGCCCGAGTTCATGGTCCCGGCCGCGGTGCTGGTGCTG
GCGGACCTGCCGCTGACGGTCAACGGCAAGGTGGACCGGCCGGCCCTGCCCGAGCCGGAC
TTCGCCGCCAAGTCGACCGGCCGGGCCCCGGCCACCGCGGCCGAGCGGATCCTCTGCGAC
GTGTTCGCCGGCGTCCTGGGCCTGGACCGGGTCGGCGTCGAGGACAGCTTCTTCGCGCTG
GGCGGCGACTCGATCTCGTCGATGCAGGTGGCCGCCCGCGCCCGGCGCGAGGGCATCGCC
CTGACCCCGCGGCAGGTGTTCGAGCACCGGACCCCGGAACGGCTGGCCGCGCTGGCGCCG
GCGGCCGGATCGGCACGACCGGACCGGTCCGCGGCGGATGCCGGCCTCGGCGAGATCCCG
TGGACGCCGGTGATGCGCGCCCTCGGCGACGACGCGGTGCGCCCCGGCTTCGCGCAGGCC
CGAGTCGTCGTCGCGCCGGCCGGCCTCGACCCGGACGCGCTCACCGGCGCCCTGCGGGCG
GTGCTGGACACCCATGACGTGCTGCGCGCGCGGGTGGAGCCGGACCGGCGGCTGATCGTG
CCCGAGCGCGGCGCGGTGGCCGCGGCGGACCTGCTGACGCGGGTGGCGGTCGACAGTGAC
GGCATCGACGCCCGCGCCGAGCGCGAGGCGGCGACGGCGGCGGGCACGCTGGATCCGTCG
GCCGGGATCATGCTGCGGGCGGTGTGGCTCGACGCCGGCGACGCCGAGCCGGGCCGGCTG
GCGCTCGTGGCGCATCACCTGGTGGTCGACGCGGTGTCGTGGAGCATCCTGCTGCCGGAC
CTGCAAGCGGCGTACCAGGAGGTGCTCGCCGGCGCGACCCCGGCTCTGGAACCCGCGGCG
ACGTCGTACCGGCAGTGGGCGCGGCGGCTGACCGAGCAGGCGTCCAGCCCGAGCACCCTG
GCCGAGCTCGACCACTGGGTCACCGTGCTGGACGCGGCGGAACCACCGCTGGCGGAGCAC
CACGGGCAGGCGCACTCGTGGTCGGCGACCCTGTCCGGCGCCGTGGCGGGCCACCTGGTC
AGCCGGATGCCGGGCGCGTTCCACTGCGGGATCCAGGAGGTGCTGCTCGCCGGCCTGGCC
GCGGCGGTGGCCCGCTGGCGCGGCGACGACGCCGGGGTGCTGGTGGACGTGGAGGGCCAC
GGCCGGCACGCCGCCGACGGCGAGGACCTGTTGCGTACGGTGGGGTGGTTCACCAGCGTG
CACCCGGTCCGCCTGGACGTCTCCGGCGTCGACCTGGCGGCCGCGGCGGCCGGCGACGCG
GCCGCGGGTGAGCTGCTGAAATCGGTGAAGGACCAGGTCCGCGCGGCGCCCGGCGACGGG
TTCGGGTTCGGGCTGCTGCGCCACCTCAACCCGGACACCGCCGAGCGGCTCGCCGCGTTG
CCCGCCCCGCAGATCGGGTTCAACTACCTCGGCCGGTCCGGGGTGGCCGCCGAGGCCGTC
CCGTGGCAGGTGCGCGGCGGATCGCTCGGCGCCGGGGAAGCCGGACCGGACCTGGTCCTG
GCACACCCGCTGGAGGCCGGCGCGGACGTGCGGGACACCCCGGACGGCCCGCTGCTGCGG
CTCACCCTGGACGGCCGGGATCTCGCCCCGGTCACGGTGGAGCTGCTCGGCGAGGCCTGG
CTGGAGTTGCTGACCGGTCTGGCCACCCACGCCGGCGACCCGCGGGCCGGCGGGCACACC
CCGGCCGACTTCGACCTGGTCGAGGTGACGCAGCGGGACGTGACGGCGCTGGAGGCCGCG
GCGCCGGGCCTGACCGACATCTGGCCGCTGTCGCCGCTGCAGCGGGGCATGCTCTTCGAG
CGGGCGCTGGACGAGGACGGCGTCGACGTCTACCAGAGCCAGCGCATCCTGGACCTCGAC
GGGCCGCTCGACGCGGACCGGCTGCGCGCGGCCTGGCGGACGCTGGTCGCCCGGCACGAG
TCGCTGCGCACCAGCTTCCATCAGCTGGAGTCCGGCGAGACGGTGCAGGTCGTCGTGGAC
CAGGCGGACATCGGCTGGCGGGTGGCCGACGTGTCACACCGGGCTGAGGCGGACGCGGCC
GCGGAGGTCGGACGACTGCTCGCCGAGGACCAGGCGCAGCGGTTCGACGTCACCCGGGCG
CCGCTGCTGCGGCTGTTGCTGGTCCGGCTCGGCGCGGACCGGCACCGGCTCGTGGTGACG
TCGCACCACATCGTCCTGGACGGCTGGTCGACGCCGATCATCCTGGGCGAGATGTCGGCG
GCGTACGCGGGTGCGCCGAGCACGGCGACGGCGCCCTCGCCGCGGGACTACCTGGCGTGG
CTGAACCGCCAGGACGACGCGGCGACCCGCGCGGCGTGGCGCTCCGAGCTCGCCGGCTGC
GACGAACCGACCCTGGTGGACGCCGACGCGGACAAGACCATGGTGATGCCGGGGGAGCAC
TGCGAAGGACTGTCGGAGCAGGCCACCCGCCGTCTCACCGAGTTCGCACGGGGTCATGCG
GTGACGCTGAGCACGATCCTGCAGGGCGCCTGGGCGCTGGTGCTGGCGCGGCTGGCGGGC
CGGACCGACGTGGTGTTCGGGACGGTGGTGTCCGGACGCCCCGCCGAGGTGCCGGACGTC
GACCGGATGGTGGGGATGTTCATCAACACCGTCCCGGTCCGGGTGCGCCTCGACGGCGGC
CGGCCGGTGCTGGACCTGCTGCACGACCTGCAGGCACGCCAGTCCGCGCTGACCGAGCAC
CAGCACCTGGGGCTGCCGGACATCCAGCGGGCGGCGGGTCCCGGCGCGCTGTTCGACACC
ATCATGATGGTCGAGAACTACCCGATGGACGCCGCCGGCCTGGGCGGCGAGGGTGGTGTC
AGGATCGGCTCGGTCCTCACCCGGACCGGCACCAGCTATCCGCTGACGATGAGCGCGAGC
CCCGGCGAGCGCCTGCAGATCCGGGTGTCCTACCGGCCCGACCGCATCGAGCGGGAGACC
GCCGCCGAGGCGGCCGGGCAGGTCGTACGGGTCATCGAACGCATCGTGGCGGAGCCGTCG
CTCGCGGTGGGCCGCCTGGGTGTGACCGGCGAATCGGTGCGCGAGCGCGTGGTGGAGCGC
TGGAACGCGACCGGCGTGGCGGCCGGCGGGTCGTCGGTGCTGACCGGGTTCCGGCGGCGT
GCGCGCAGCTCACCGGACGCGGTGGCGGTCAGCGGCGGCGGGCGGACCCTGTCCTACGCC
GCCCTGGACCGGGAATCCGACCGGCTCGCGGGGCATCTGGCCGGCCGGGGTGTGCGGCGT
GGCGACCGCGTCGGCGTGGTGATGGAACGCGGCACCGATCTGTTCGTCGCCCTCCTCGCG
ATCGGCAAGGCGGGCGCGGCGTACGTCCCGGTGAACCTGGACTACCCCCGGGACCGGATC
GAGCGGATGCTGACCGACGCCGGCGTATCGGTGGCGGTCTGCGTGCAGGCGACCAGCGGC
GCGGTGCCGGACGGCCTCGCGCCGGTGGTCATGGACTCACCGGCGATCGCCGCGGCGCCG
TCCGAGGCCCCGCCGATCACGGTGGGCGCGCACGACCTGGCGTACGTGATGTACACCTCC
GGGTCCACCGGGGTGCCGAAAGGCGTCGCGGTGCCGCACGGCAGCGTGGCGGCGCTGGCC
GGTGACCCGGGCTGGTCGGTCGGCCCCGGCGACGGCGTGCTGATGCACGCCCCGCACGCG
TTCGACGCGTCGTTGCTGGAGATCTGGGTGCCGCTGCTGAGCGGGGCCCACGTGGTGGTC
GCGGACCCGGGCGCGGTGGACGCGCAGCGGCTGCGCGAGGCGATCGACCGCGGGGTGACC
ACCGTCCATCTGACGGCCGGGTCGTTCCGGGTGCTGGCGGAGGAGTCGCCGGACGCCTTC
CGCGGACTGCGGGAGGTTCTGACCGGCGGCGACGCGGTGCCGCTCGCCTCCGTCGTACGG
TTGCGCGAGACCTGCCCCGAGATCCGGGTCCGGCACCTCTACGGCCCCACCGAGACCACC
CTGTGCGCCACCTGGCACCTGATCGAGCCGGGGGTCGCCACCGGCGACACCCTGCCGATC
GGCCGGCCGCTGGCCGGGCGGCGAGCGTACGTGCTCGACGCGTTCCTGCAACCGGTGGCC
CCGAACGTGACCGGCGAGCTCTATCTGGCCGGCGCCGGGCTGGCGCGCGGCTATCTGGGC
GCCGCCGCCGCGACCGCGGAGCGGTTCGTCGCCGACCCGTTCGCCGCCGGTGAGCGGATG
TACCGCACCGGGGACCTGGCGCGCTGGACGGAACAGGGCGAGCTGCTGTTCGCCGGCCGC
GCCGACGCCCAGGTGAAGATCCGCGGCTACCGGGTCGAGCCGGCGGAGATCGAGGCGGCG
CTGACCGCGATCCCCGAGGTCGCGCAGGCGGTCGTGGTGGCCCGCGAGGACGGCCCGGGC
GAGAAACGGCTGATCGCCTACGTCACCGCGGCCGGGCAGCCGGGACCGGACCCCGCCGCG
GTACGCGAACACCTGGGCGAGCGGCTGCCGGAGTTCATGGTGCCGGCCGCGGTGGTGGTG
CTGGACGGCTTCCCGCTGACGATCAACGGCAAGATCGACCGAGCGGCCCTGCCCGCCCCC
GAACGCAGCGGGAAGCCGGCCGGCCGCGAGCCGCGTACCGAGGTCGAGCGGGTGTTGTGC
GACCTGTTCGCCGACCTCCTCGGGCTGGACCGGGTCGGGGCCGACGACAGCTTCTTCGAA
CTGGGCGGCGACTCGATCGTGTCGATGCAGCTGGCCGCCCGCGCACGTCGCGAGGGCGTC
GTCTTCGGCGCGAAGGACGTCTTCGAGCAGAAGACGCCGGCGGCCATCGCCGCGGTCGCG
GTGCGCGGCGGTCAGCGGCCGGCCGGTCCCGACGACGGGGTCGGCGAGGTCGCCTGGACG
CCGGTGATGCGGGGCCTGCTCGACCGTGACCCCGGCACGATGAACCGCAGCGCCATGGCG
CAGTGGGTGACCGTGGGCGCGCCCGACACCCTGTCGCGCGACGTGCTGGCGGCCGGGCTG
GGAGCCGTGCTCGACGCCCATGACATGCTGCGCAGCCGCGTCGTCGCGGCCGGGACGGAA
GAGCCGCGGCTGGTGGTGGCGCCGCGGGGCGCGGTGCACGCGGCCGGGCTGGTGGACCGG
GTCGAGGCGGGCGCCGGCGAGGTCGACGACCTCACCGAGCGCAGCGCCGCCGAGGCGGCC
ACGCGGTTGGATCCGGGCGCCGGCGTGATGGTCCGGGCGGTGTGGGTCGACGCGGGCCCC
GGCCGCGTCGGACGGCTCGTGGTGGTGGCGCACCACCTGGTGGTCGACGCGGTGTCGTGG
CGGATCCTGCTGCCGGACCTGCGCGCGGCGTGCGAGGCGGTGGCCGCGGGCCGGGAGCCG
GCGCTCGATCCGGTGGACGTCTCGTTCCGGCGCTGGGCGCGGACGCTGACCGATCAGGCG
GCCACCCGGACCGCGGAGCTGGCCACGTGGACGCGGATCCTGGGCGGGGCGCAGCCGCGG
TTCGGCGCGCTCGACCCCGGACGCGACACCATCTCGACCGCCGGCCGCCGGACGTGGACG
GTGCCGCAGGACCGGGCCGGCGTGCTGGTGGAGAGGGTCACCTCGGCCTTCCACTGTGGT
GTGCACGAGGTGCTGCTGGCCACCCTGGCGGGCGCGGTGGCCCGATGGCGCGGCGGCGCC
GCCGTCGTGGTGGACGTCGAAGGTCACGGCCGCCGGCCGCTCGGCGAGATGGACCTGTCG
CGCACGGTCGGCTGGTTCACCGACGTGCACCCGCTCCGGCTGGACGTGACCGGGATCGAC
ACGGCCGAGGTGATCGCCGGTGGCGGCGCGGCCGGCCGCCTGCTGAAGACCGTCAAGGAG
AACGTGCGTGCCGTGCCCGACGGCGGGCTCGGCTACGGGATGCTGCGCCACCTCAACGCC
GAGACCGGGCGGGTGCTGGCGGCACAGCCGGCAGCCGAGATCGGGTTCAACTACCTGGGC
CGCTTCTCCGAGGGGCCCGGCGGTGACGTGCAGCCCTGGCAGCAGCTGGGGACGATCGGC
GGTACGGCGGAGCCGGACATGCCGTTGCGGCACGCCGTGGAGATCGACGCGGCCGTGCTC
GACGCGGCCGACGGGCCCCGGCTGGAGCTGACCGTCACCTGGGCCGGGCGGCTTGTCGGC
GCGGCCGAGGCCGAGTCGCTCGGCAGGGCTTGGCAAGACGTGCTGGCCGGTCTGGCGGTA
CACGCCGGCGACGTCCGCGCCGGCGGGCACACCCCGTCCGACTTCCCGCTGACCGCGCTG
AGCGGGCAGGAGGTGGCGCAGATCGAGGCCGCCGTGCCGGACCTGCTCGACATCTGGCCG
CTCTCCCCGCTGCAGGAGGGCCTGCTGTTCCATGCCGTCGACGAGCGCGGCCCGGACGTC
TACGCCAGCATGCGGACCCTGGCCGTCGACGGCCCGCTGGACGTGGCCCGGTTCCGCGCG
TCCTGGCAGGCCGTGCTGGACCGGCACGCCGCCCTGCGGGCGAGTTTCCATCAGCTCGAG
TCCGGCGCGGCCGTGCAGGCGATCGCCCGCGAGGTGACGCTGCCCTGGCAGGAGACCGAC
CTGTCGGATCTGCCCGAGGACGTGGCGCTGGCGGAGTTCGACCGGCTCGCGGCGCAGTTG
CGCGACGAGCGGTTCGACCTGACCCGGGCGCCGCTGCTGCGCCTGCACCTGGTGCGTCTC
GGCGAGCGCCGGCACCGGCTGGCCTTCGCGTCGCACCACATCTCGTGCGACGGGTGGTCA
CTCCCGATCGTCTCCACCGAGGTGATGGCGGCGTACGAGGGTCGCGGCCTGCCGGCGCCG
ACGTCGTACCGTGACTACCTGGTCTGGCTGGCCCGCCAGGACAAGGAGGCCGCCCGGCAG
GCGTGGCGCGGCGAACTGGCCGGGCTCGACGAGGCCACCCACGTCGTGCCGCCGGACACG
ATCACCGCGCCGATCGCGCCGCAGCGGGTACGGTTCGGGCTCGACGACGAGCTGAGCCGG
CGCCTGGTGCGGTTCACCCGCCGCCACGGCGTCACGATGAACACCCTCTTCCAGGGGATC
TGGTCGTTGCTGCTGGCCCGGCTGACCGGCCGCGACGACGTGGTCTTCGGTTCCGCCGTG
GCCGGGCGGCCCGCGGAGATCCCCGGCGTCGGGTCCGTGGTCGGGCTGTTCATGAACACC
GCGCCGGTCCGGGTGCGCCTCGACGGCGCCGAACCGTTCCTGGACATGCTGACCGACCTG
CAGCGGCGGCAGGTCGCGATGATGGCCCACCAGCACCTCGGGCTGAGCGAGATCAAACAG
GTCGCCGGTCCGGGGGCGGCGTTCGACACGCTGGTGGTGTTCGAGAACTACCCGCGCCCG
CCGCGCCCGTCCGACGACCCGGACGCGGTGGTCATGCGCCCGGCGGAGATCCCGGAGGAC
AGCGGGCACTACCCGGTGTCGATGCGCGCCTCCGAGGACGGCGGCGTCCACGGCGAGTTC
ATCTTCCGTCCGGACGCGTTCGACCGGGCCGAGGCCGAGGGGATGCTCGCCGCGATCATC
GAGGCCCTGCGGCAGGTGGTGGCCGAACCGGGGATTGCGGTGGGGCGCATCGGTCTGGTC
GGCGCGGCCGAGCGCCGGCAGGTGGTGCGGGAGTGGAACGAGACCGATGCGCCGCTGACC
GCGCAGCCGCTGCCGATGCTGTTCCGCCGGCAGGCGCAGCGCTCCCCGGACGCGGTGGCG
GTGCGCGACGCGGCGCGCAGCCTGTCGTTCGGCGCGCTGCTGGGCGAGGCCGAGGGGCTC
GCCCGGCGGCTGGTGGCCTCCGGCGTACGGCGGGGAGACCCGGGTGGCCGTGCTCTGGAA
CGCTCGGCGGAGCTGGTGGTGGCCCTGCTCGGGGTGTCGCTGGCCGGCGGGGTGTTCGTG
CCCGTCGACCCGGACTACCCCGGCGACCGGATCGCGCTGATGCTGGCGGATGCGGCGCCG
CAGGTGCTGGTGTGCACGGCGCGGACCCGCTCGGTCGTGCCGGGCGACTTCGCCGGCGCG
GTGCTGGCGCTGGACGAGCCGTCCGCGGCCGGCCCGCAGGTGTCGCTGCCGCGGGTGGCG
GCGCGGGACGGGGCGTACGTGATCTACACGTCCGGGTCGACGGGTGTGCCCAAGGGCGTG
CTGGTCACCCACGCCGGGCTCGGCAACCTGGCGAGCGCGCAGATCGAGCGGTTCGGCGTG
ACGTCGTCCTCGCGGGTCCTGCAGTTCGCCGCGCTCGGGTTCGACGCCGCCATCTCCGAG
GTGTGCATGGCCCTGCTCTCGGGCGGGAGCATCGTGCTGGCCGACGCCGAGCACATGCCG
CCGCGGGTGTCGCTGGGCGACGCGGTACGCCGGTGGGACATCACCCACGTCACCGTGCCG
CCGAGCGTGCTGGCCGTCGAGGACGACCTGCCGGACGACCTCACCCTGATCGTGGCCGGC
GAGGCCTGCCCGCCCGCGCTGGTGGACCGCTGGTCGCCGGGCCGCCGGATGATCAACGGC
TACGGGCCCACCGAGACGACCGTGTGCGCGACGATGAGCTCCCCGCTGTCCCCGGGACGC
GGCGCGGTGCCCATCGGCGGCCCGATCGCCAACATGCGGACCTACGTGCTCGACGCCTTC
CTGCAGCCGGTGCCGCCGGGCATGACCGGCGAGCTCTACGTCACCGGGGTCGGGCTCGCC
CGCGGATATCTCGGGCGTCCGGGGCTGACCGCGGAACGGTTCGTGGCCGACCCGTTCTCG
CCGGGTGGCCGGATGTACCGCACCGGCGACCGGGCCCGCTGGACCGGCGACGGCGAGCTG
GTCTTCGCCGGCCGGGTCGACGCGCAGGTCAAGGTGCGCGGATACCGGATCGAGCCGGGG
GAGATCGAGGCCGTGCTGGCCGAGCACCCGGGGGTCGCCCAGGTGGTCGTCGTGGCCCGC
CAGGACGGGCCGGGCGAGAAGCAGCTGGTGGCCTATGTCGTCCCGGCGGCCGGCCCGACC
GCCGAGGCGAGCACCCTGATCTCCGCGCTGCGCGAGGCGGCGGCCGCCCGCCTGCCGGAG
CACATGGTGCCGGCGGCGTTCGTGCCGCTGGACGCGATGCCGCTGACGCCCAACGGCAAG
GTCGACCACCGGGCGCTGCAGGCTCCCGACTTCGCCGGGATGTCGGCCGGGCGGGACCCG
CGTACGGCCTTGGAGGCCAAGCTGTGCGAGCTGTTCGCCGAGGTGCTCGGCCTGGAGCAG
GTGGGCGCCGACGACAGCTTCTTCGAGCTCGGCGGCGACTCGATCACCTCGATGCAGCTG
TCCACCCGGGCCCGCCGGGAGGGGCTGGAGCTGACCCCGTGGCAGGTGTTCGACGAGAAG
ACGCCGGAACGGCTGGCGGCGCTCGTCAAAGAGATCCCGGCCGACGGCGGGGCCACCGGG
GCGCCGGAGCCCGCGGCGGGCACGCTCGTCGCGCTCTCGCCTGAACAGATGGACCAACTC
GAGGCCGGACCGGCCGGCGAATGA
[4] C7..301
[4] A481..876
[4] L-4-hydroxyphenylglycine(Hpg)646..746
[4] PCP954..1020
[4] E1060..1496
[5] C1506..1797
[5] A1978..2372
[5] L-4-hydroxyphenylglycine(Hpg)2142..2242
[5] PCP2455..2521
[5] E2555..3007
[6] C3019..3307
[6] A3490..3877
[6] tyrosine3655..3749
[6] PCP3964..4030
[4] C19..903
[4] A1441..2628
[4] L-4-hydroxyphenylglycine(Hpg)1936..2238
[4] PCP2860..3060
[4] E3178..4488
[5] C4516..5391
[5] A5932..7116
[5] L-4-hydroxyphenylglycine(Hpg)6424..6726
[5] PCP7363..7563
[5] E7663..9021
[6] C9055..9921
[6] A10468..11631
[6] tyrosine10963..11247
[6] PCP11890..12090

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [481-876]  2.90000000000003e-115 PF00501 [1978-2372]  3.39999999999996e-106 PF00501 [3490-3877]  2.90000000000003e-103 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  2.50000000000001e-68 PF00668 [1060-1327]  1.6e-34 PF00668 [1506-1797]  3.90000000000001e-69 PF00668 [2555-2836]  3.2e-31 PF00668 [3019-3307]  8.1e-61 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [979-994]  PS00012 [2480-2495]  PS00012 [3989-4004]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [954-1020]  PS50075 [2455-2521]  PS50075 [3964-4030]  PS50075
PS50075   ACP_DOMAIN
 [947-1021]  1e-17 SSF47336 [2448-2522]  2.70000183580794e-18 SSF47336 [3957-4031]  1.39999892049878e-19 SSF47336
SSF47336   ACP_like
 [944-1019]  9.00000000000011e-76 G3DSA:1.10.1200.10 [2447-2520]  9.00000000000011e-76 G3DSA:1.10.1200.10 [3957-4031]  9.00000000000011e-76 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [958-1018]  2.2e-12 PF00550 [2458-2518]  4.00000000000001e-12 PF00550 [3967-4029]  1.1e-12 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1342-1496]  1.9e-25 TIGR01720 [2851-3007]  3.60000000000002e-38 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [481-876]  2.50000000000001e-128 TIGR01733 [1978-2372]  3.70000000000004e-124 TIGR01733 [3490-3877]  5.30000000000001e-121 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [955-1023]  2.2999993566538e-07 SM00823 [2456-2524]  2.10000037262656e-08 SM00823 [3965-4033]  3.1999989904635e-08 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [600-611]  PS00455 [2096-2107]  PS00455 [3607-3618]  PS00455
PS00455   AMP_BINDING
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [72-172]  3.60000000000001e-11 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit