close all open/close all

CDS information : Teicp_00150


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction35,694 / 41,276 / + [in whole cluster]
35,694 / 41,276 / + [in contig]
Location35694..41276 [in whole cluster]
35694..41276 [in contig]
TypeCDS
Length5,583 bp (1,860 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase, module 7
Gene
Gene (GenBank)teiD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[25586301] Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis. (Proteins. , 2015)
Related Reference
ACC
Q70AZ6
NITE
Teicp2_00210
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

A7 L-3,5-dihydroxyphenylglycine(Dpg)
C15..310
A493..894
PCP976..1043
X1057..1356
TE1630..1836

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 7]
MTVDDTRAKPRSSVEDVWPLSPLQEGMLYHTALDGDGPDTYTVQTVYGIDGPLDAGRLRA
SWQALVDRHAALRACFRYVSGAQMVQVIQRDVELPWRETDLSGLPEDLADGEVARLAEQE
MAERLRLEAAPLMKLHLIRLGPQRHRLVHTLHHVLVDGWSMPILHRELAAIYAAGGDASG
LPPAVSYRDYLAWLGRQDKESARAAWRDALAGLDTPTTVAPADPARVPDIDTAMVELSPE
LTDDLLRLARGHDLTLNTVVQGVWAVVLAQLAGRTDVVFGATASGRPAELAGVEAMVGLL
LATLPVRVRLDGRQRVVDMLADLQRDQSALRAHQHLGLQEVQAVVGPGAVFDTLVIYENF
PRTGLGGSADDGLVMRPVQKGRDSSHYPFTLVTGPGERMPVILYYDRGLFDQAAATSVLG
AIVRVLERLVAEPGVLVGRLTLLGEAERAVVVDDWNATAGPVPGDSMVDVFDRRVAAAPD
TVAITDADGADLTYAEVDQASNRLAAHLADRGVRRGDRVGVAVERSADLPIVFLAIWKAG
AAYVPVDVGYPAERIALILAGSAVSTVICTQATEAAVPQNVPQRATIVLDAPPTRAAVDA
CAGTAPTFRPSAADLAYVMYTSGSTGVPKGVAVPHGAVAGLAGDAGWRIGPGDGVLMHAT
HVFDPSLYEMWVPLATGGRVLVAAPGVVDAGGIRQAVARGATAVHLTAGTFRALAEASPD
CFAGLREVGTGGDVVPAHTVAHLRRAQPQLRVRNTYGPTETTLCATWKPIEPGAQLGPEL
PIGRPMTNRRIYILDAFLRPVAPGVAGELYIAGTGLARGYLSRPDLTAERFVACPFLAGE
RMYRTGDLARWNRDGEVVFLGRADDQVKIRGYRVELAEVEAVLAAQPGVREAVVVAREDR
PGERRLVGYVVSDAGELDTEQIRQQMARVLPGYMVPVAVIGLVSLPITANSKVDRRALPA
PDLAGHASAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREEL
GVDLPIRQLFSSPTPAGVARALAAKSRPALEAVTRPERVPLTARQLRAWLLARPSEETRG
RHLSVALRLRGRLDVAALEAALRDVAARHEILRTTFPGDAQTVHQHIHDAAPVRLTPVPA
TEEDLPARLAERGEQLFDLTRDMPWRCELFALSEKEHVLSVTVHRIAADDDSMDVFFRDL
AAAYGARRAGRAPERAPLALQFADYAIWEQRLLDGEREQDSLINDQITFWRNHLAGIDQE
TVLPFDRARPAIPSRRAGTVALRLDAGPHARLAEAVESAGADMPQLVQAALAMLLTRYGA
GTDLVIGTTLPRDEDLIDLEPMIGPFARPFPVRTDLSADPTFLEVVARVQEAVREARQHL
DVPFEKIPELLALPGSLSRHPVYQVGLQVREEDNGAWDAAELPALRTSVEPTGVEAIELD
LAFALTERRNDDDDEDGIEGALHYAADLFDHDTAASLARRLVRVLEQVAEDPGRRISDLD
ILLDDAERGAPAIAPARWAGAVPAAVADLVAAGPLGALVLDEAQRPVAPGTVGDLWVTGP
AVDADTGGRPSVPCPFGTPGHRMLHTGLLARKSPARTLVVVGERRGASASAKTGDYEVLL
PLRAAGDRAPLFCIHASGGLSWNYGPLLRHLPPNQPVYGVQARGLARTEPLPGSVEEMAA
DYVEQIRTVQPTGPYHLLGWSLGGRIAQAMAVLLEADGEKVGLLALLDAYPVYMGRKATG
TVTEEAARDEDALERRKQQELELAGQLVQGAGARSRLEAVMRNLWEVGPAHTASPFASDV
LLFVASVDRPAHLPVSEAIASWKDFTGGTIATNHYEMVQPAALAQIGAIVAEKLRSRPDA
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase, module 7]
GTGACCGTTGACGACACTCGTGCAAAGCCCCGCTCCAGCGTGGAAGACGTCTGGCCGCTG
TCGCCGCTGCAGGAGGGCATGCTTTACCACACCGCCCTGGACGGGGACGGGCCGGACACC
TACACCGTGCAGACCGTCTACGGCATCGACGGCCCGCTGGACGCCGGGCGGCTGAGAGCG
TCGTGGCAGGCCCTGGTGGACCGGCATGCCGCCCTGCGGGCCTGCTTCCGCTACGTCAGC
GGCGCGCAGATGGTGCAGGTCATTCAGCGGGACGTCGAGCTCCCGTGGCGGGAGACCGAC
CTGTCCGGGCTGCCGGAGGACCTCGCCGACGGTGAGGTGGCCCGCCTGGCGGAGCAGGAG
ATGGCCGAGCGCCTGCGCCTGGAGGCCGCGCCGCTGATGAAACTGCACCTGATCCGGCTC
GGCCCGCAGCGCCACCGGCTCGTGCACACCCTGCACCACGTGCTGGTGGACGGCTGGTCG
ATGCCGATCCTGCACCGTGAGCTCGCGGCGATCTACGCGGCGGGCGGGGACGCGTCCGGG
CTGCCGCCCGCGGTGTCGTACCGCGACTATCTGGCCTGGCTGGGCCGGCAGGACAAGGAG
TCGGCGCGGGCGGCGTGGCGGGACGCGCTCGCCGGGCTGGACACCCCGACCACGGTCGCG
CCGGCCGATCCGGCCCGCGTGCCGGACATCGACACGGCGATGGTGGAGCTGTCCCCCGAG
CTGACCGACGACCTGCTCCGGCTGGCGCGTGGCCACGACCTCACGCTCAACACCGTCGTG
CAGGGCGTGTGGGCGGTCGTGCTGGCGCAGCTGGCCGGCCGTACCGACGTGGTGTTCGGC
GCGACCGCCTCGGGGCGGCCGGCCGAGCTGGCCGGGGTGGAGGCGATGGTCGGGCTGCTG
CTGGCCACCCTGCCGGTGCGGGTCCGGCTCGACGGGCGCCAGCGGGTCGTCGACATGCTC
GCCGACCTGCAGCGCGACCAGTCGGCGCTGCGCGCGCACCAGCATCTCGGGCTGCAGGAG
GTGCAGGCCGTCGTCGGGCCCGGAGCGGTCTTCGACACGCTGGTCATCTACGAGAACTTC
CCGCGTACGGGCCTCGGCGGATCGGCCGACGACGGCCTGGTCATGCGGCCGGTGCAGAAG
GGGCGCGACTCCTCGCACTACCCGTTCACACTGGTCACCGGTCCGGGCGAGCGGATGCCG
GTGATCCTCTACTACGACCGGGGGCTGTTCGACCAGGCGGCCGCCACATCGGTGCTCGGC
GCGATCGTCCGCGTGCTGGAGCGGCTGGTCGCCGAGCCCGGTGTGCTCGTCGGCCGGCTG
ACGCTGCTGGGCGAGGCCGAGCGCGCCGTGGTGGTCGACGACTGGAACGCGACCGCGGGC
CCGGTCCCCGGCGACTCCATGGTGGACGTGTTCGACCGGCGGGTGGCCGCCGCGCCGGAC
ACGGTGGCGATCACCGACGCCGACGGCGCCGACCTCACCTATGCCGAGGTCGATCAGGCG
TCGAACCGGTTGGCGGCCCACCTCGCCGATCGGGGCGTCCGCCGCGGCGACCGCGTCGGG
GTGGCCGTGGAGCGGTCCGCGGACCTGCCGATCGTGTTCCTGGCGATCTGGAAGGCCGGC
GCCGCGTACGTCCCGGTGGACGTCGGGTACCCGGCCGAGCGGATCGCGCTGATCCTCGCC
GGCTCCGCGGTCTCGACGGTGATCTGTACGCAGGCCACCGAGGCGGCGGTGCCGCAGAAC
GTGCCGCAGCGCGCCACGATCGTCCTCGATGCGCCGCCGACGCGGGCGGCCGTGGACGCC
TGTGCCGGCACCGCGCCGACGTTCCGGCCGAGCGCCGCCGACCTGGCGTACGTCATGTAC
ACCTCGGGCTCCACCGGCGTCCCGAAGGGCGTGGCCGTCCCGCACGGCGCGGTCGCCGGC
CTGGCCGGCGACGCGGGCTGGCGGATCGGCCCCGGCGACGGCGTGCTGATGCACGCGACG
CACGTGTTCGACCCCTCGCTCTACGAGATGTGGGTGCCGCTGGCCACGGGTGGCCGGGTC
CTGGTGGCCGCTCCCGGAGTGGTCGACGCGGGCGGGATCCGGCAGGCCGTGGCACGCGGC
GCGACCGCCGTCCACCTCACCGCCGGCACCTTCCGCGCGCTGGCGGAGGCGTCCCCGGAC
TGTTTCGCCGGCCTGCGCGAGGTCGGCACCGGCGGCGACGTGGTGCCCGCGCACACCGTG
GCCCACCTGCGGCGGGCCCAGCCACAGCTGCGGGTGCGCAACACGTACGGGCCGACCGAG
ACCACCCTGTGCGCCACCTGGAAGCCGATCGAGCCGGGCGCGCAGCTCGGGCCGGAGCTG
CCGATCGGCCGTCCGATGACCAACCGCAGGATCTACATCCTGGACGCCTTCCTGCGCCCG
GTCGCCCCCGGGGTGGCCGGCGAGCTGTACATCGCCGGCACCGGACTGGCCCGCGGATAT
CTCTCCCGGCCGGACCTGACCGCCGAGCGGTTCGTGGCGTGTCCGTTCCTCGCCGGCGAG
CGCATGTACCGGACCGGGGACCTGGCGCGCTGGAACCGCGACGGCGAGGTGGTCTTCCTC
GGGCGCGCCGACGACCAGGTGAAGATCCGCGGCTACCGGGTGGAGCTGGCCGAGGTGGAG
GCGGTGCTGGCGGCCCAGCCGGGAGTCCGCGAGGCGGTCGTCGTGGCCCGCGAGGACCGG
CCGGGCGAACGGCGTCTGGTCGGCTACGTCGTCTCCGACGCCGGTGAGCTGGACACCGAA
CAGATCCGCCAGCAGATGGCCCGGGTGCTGCCCGGCTACATGGTTCCGGTGGCGGTCATC
GGGCTGGTCAGCCTGCCGATCACCGCCAACAGCAAGGTGGACCGCCGGGCCCTGCCCGCC
CCGGACCTCGCCGGCCACGCGTCGGCGAAGGCGCCGGAGAGCGCGACCGAGAAGGTGCTG
TGCGCGCTCTACGCCGAGATCCTCGGCGTCGAGCGGGTGGGCGTCGACGACGCCTTCCAC
GACCTGGGCGGCAGTTCGGCGCTGGCCATGCGGCTGATCGCGCGGATCCGCGAGGAGCTG
GGCGTGGACCTGCCGATCCGCCAGCTGTTCTCCTCGCCCACACCCGCGGGGGTGGCCCGG
GCGCTGGCCGCGAAGTCGCGCCCCGCGCTGGAGGCGGTCACCCGGCCGGAGCGGGTGCCG
CTCACCGCCCGGCAGCTGCGCGCCTGGCTGCTGGCCCGCCCGTCGGAGGAGACCCGGGGC
CGGCACCTCTCGGTCGCGCTGCGCCTGCGCGGCCGGCTGGACGTGGCCGCCCTGGAGGCG
GCGCTGCGCGACGTCGCGGCCCGGCACGAGATCCTGCGGACCACCTTCCCGGGCGACGCG
CAGACCGTCCACCAGCACATCCACGACGCCGCGCCGGTCCGGCTGACGCCGGTCCCGGCC
ACCGAGGAGGACCTCCCCGCACGGCTGGCCGAGCGGGGCGAGCAGCTGTTCGACCTCACC
CGGGACATGCCGTGGCGGTGCGAGCTCTTCGCGCTGTCGGAGAAGGAGCACGTGCTGTCG
GTGACGGTGCACCGCATCGCCGCCGACGACGACTCGATGGACGTGTTCTTCCGGGACCTC
GCGGCCGCGTACGGCGCGCGGCGGGCCGGCCGGGCCCCGGAGCGCGCGCCGCTGGCCCTG
CAGTTCGCCGACTACGCGATCTGGGAGCAGCGGCTGCTCGACGGCGAGCGCGAGCAGGAC
AGCCTGATCAACGACCAGATCACCTTCTGGCGCAACCACCTGGCCGGCATCGACCAGGAG
ACCGTGCTGCCGTTCGACCGAGCGCGGCCGGCCATCCCGTCGCGCCGGGCCGGCACGGTC
GCGCTGCGGCTGGACGCCGGTCCGCACGCCCGGCTGGCCGAGGCGGTGGAATCGGCCGGC
GCGGACATGCCGCAGCTCGTGCAGGCCGCGCTGGCCATGCTGCTGACCCGGTACGGCGCG
GGCACCGACCTGGTGATCGGCACGACGCTGCCGCGCGACGAGGACCTGATCGACCTGGAG
CCGATGATCGGGCCGTTCGCCCGGCCGTTCCCGGTGCGTACCGACCTGTCGGCGGATCCG
ACCTTCCTGGAGGTCGTCGCCCGGGTGCAGGAGGCGGTCCGCGAGGCGCGCCAGCACCTG
GACGTGCCCTTCGAGAAGATTCCCGAGCTGCTGGCCCTGCCCGGCTCGCTGTCGCGCCAC
CCGGTGTACCAGGTCGGGCTGCAGGTGCGCGAGGAGGACAACGGCGCGTGGGACGCCGCG
GAACTGCCCGCCCTGCGCACCAGCGTCGAACCCACCGGGGTCGAGGCCATCGAGCTGGAC
CTGGCGTTCGCGCTCACCGAGCGCCGCAACGACGATGACGACGAGGACGGCATCGAGGGC
GCCCTGCACTATGCCGCCGACCTGTTCGACCACGACACGGCCGCGTCGCTGGCCCGGCGG
CTGGTCCGCGTCCTGGAACAGGTGGCCGAGGATCCCGGGCGGCGGATCAGCGACCTGGAC
ATCCTCCTCGACGACGCCGAGCGCGGCGCTCCGGCGATCGCGCCGGCGCGCTGGGCCGGG
GCGGTGCCGGCGGCGGTCGCCGACCTGGTCGCGGCCGGCCCGCTCGGTGCGCTGGTGCTC
GACGAGGCACAGCGCCCGGTGGCGCCCGGGACCGTCGGCGACCTGTGGGTGACCGGTCCC
GCGGTGGACGCGGACACCGGCGGCCGGCCGAGCGTGCCGTGTCCGTTCGGGACCCCGGGG
CACCGGATGCTGCACACCGGTCTGCTCGCCCGTAAGTCGCCGGCCAGGACGCTGGTCGTC
GTGGGGGAGCGGCGCGGGGCGAGCGCCTCGGCGAAGACCGGTGACTACGAGGTGCTGCTG
CCGCTGCGCGCCGCGGGTGACCGGGCGCCGCTGTTCTGCATCCACGCCAGCGGCGGCCTG
AGCTGGAACTACGGTCCGCTGCTGCGGCACCTGCCGCCGAACCAGCCGGTCTACGGGGTG
CAGGCGCGTGGCCTGGCCCGTACCGAGCCGCTGCCCGGCAGCGTGGAGGAGATGGCCGCC
GATTACGTCGAGCAGATCCGCACCGTGCAGCCGACCGGGCCGTACCACCTGCTCGGCTGG
TCTCTGGGCGGGCGGATCGCGCAGGCGATGGCCGTGCTGCTGGAGGCGGACGGGGAGAAG
GTCGGCCTGCTCGCCCTGCTCGACGCCTATCCCGTCTACATGGGAAGGAAGGCCACCGGC
ACGGTCACCGAGGAGGCCGCCCGCGACGAAGACGCCCTGGAACGGCGCAAGCAGCAGGAA
CTGGAGCTCGCCGGTCAGCTGGTCCAGGGGGCCGGCGCCCGGTCCCGCTTGGAGGCGGTC
ATGCGCAACCTCTGGGAGGTCGGGCCGGCCCACACCGCCTCGCCGTTCGCCAGTGATGTC
CTCCTCTTCGTCGCCTCCGTGGACCGTCCCGCGCATCTGCCGGTGTCCGAGGCGATAGCC
AGCTGGAAAGACTTCACCGGGGGGACGATCGCGACCAACCACTACGAGATGGTGCAGCCC
GCGGCGTTGGCCCAGATCGGGGCCATCGTCGCCGAGAAACTCCGGTCCCGGCCGGATGCG
TGA
[7] C15..310
[7] A493..894
[7] L-3,5-dihydroxyphenylglycine(Dpg)664..764
[7] PCP976..1043
[7] X1057..1356
[7] TE1630..1836
[7] C43..930
[7] A1477..2682
[7] L-3,5-dihydroxyphenylglycine(Dpg)1990..2292
[7] PCP2926..3129
[7] X3169..4068
[7] TE4888..5508

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [493-894]  3.19999999999996e-106 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1630-1836]  1.1e-31 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [15-310]  1.79999999999997e-65 PF00668 [1057-1356]  1.6e-54 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [979-1042]  2.80000000000001e-13 PF00550
PF00550   PP-binding
 [967-1046]  2.1e-27 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [976-1043]  PS50075
PS50075   ACP_DOMAIN
 [969-1044]  1.50000306971104e-19 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [493-894]  1.9e-129 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [618-629]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit