close all open/close all

CDS information : Teicp_00170


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction41,804 / 42,625 / + [in whole cluster]
41,804 / 42,625 / + [in contig]
Location41804..42625 [in whole cluster]
41804..42625 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productdeacetylase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
  • N-acyl-glucosamine moiety
Note
Note (GenBank)
  • ORF2*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[17044690] Glycopeptide biosynthesis: Dbv21/Orf2 from dbv/tcp gene clusters are N-Ac-Glm teicoplanin pseudoaglycone deacetylases and Orf15 from cep gene cluster is a Glc-1-P thymidyltransferase. (J Am Chem Soc. , 2006)
[17009278] Identification of a deacetylase involved in the maturation of teicoplanin. (Chembiochem. , 2006)
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)
[18559264] Crystal structures of lipoglycopeptide antibiotic deacetylases: implications for the biosynthesis of A40926 and teicoplanin. (Chem Biol. , 2008)
[21267472] Regioselective deacetylation based on teicoplanin-complexed Orf2* crystal structures. (Mol Biosyst. , 2011)
Related Reference
ACC
Q6ZZJ1
NITE
Teicp2_00230
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)
[18559264] Crystal structures of lipoglycopeptide antibiotic deacetylases: implications for the biosynthesis of A40926 and teicoplanin. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>deacetylase [hypothetical protein]
MPHDPGATRLLAISPHLDDAVLSFGAGLAQAAQDGANVLVYTVFAGAAQPPYSPAAQRMH
TIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHVEGRQKLA
VNDHSPDSDHDLVGEVADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALFATHEKNV
PVRLWEDLPYAVFKSGAVELPQGFRLGSADVSSVKPEMRSQKFQAVERYSSQMVLLNGSE
NNLFDRLDEHARQNAPHGGYGETTWPVVRSDDS
selected fasta
>deacetylase [hypothetical protein]
ATGCCTCACGACCCCGGTGCAACCCGGCTCCTGGCAATTTCCCCTCATCTGGACGACGCG
GTTCTGTCTTTCGGGGCCGGTCTGGCCCAGGCGGCACAGGACGGCGCGAATGTGCTCGTC
TATACGGTATTTGCCGGCGCCGCACAGCCTCCTTATTCCCCGGCGGCGCAGCGAATGCAC
ACGATCTGGGGCCTCGCGCCGGACGACGACGCGGTGCTCTACCGCCGGAAAGAAGACATC
GCCGCTCTTGATCACCTGAGGGTGGCTCATCGGCACGGCCGGTTCCTCGACTCCATCTAC
CGTAAGTTGCCGGACGGTCGTTGGCTGACCGCCCATGTGGAGGGCAGGCAGAAGCTGGCC
GTCAACGATCACTCGCCGGACAGCGACCATGACCTGGTTGGCGAGGTGGCGGACGACATC
AGGTCGATCATCGACGAGTTCGACCCGACGCTTGTCGTCACCTGTGCGGCCATCGGCGAA
CACCCCGACCATGAGGCGACGCGAGATGCCGCGCTGTTCGCCACGCACGAGAAGAACGTT
CCGGTACGGCTGTGGGAGGACCTGCCGTATGCGGTCTTCAAATCAGGTGCGGTCGAATTG
CCGCAGGGTTTTCGTCTCGGCTCTGCGGATGTCAGCTCGGTGAAGCCGGAGATGCGGTCG
CAGAAATTCCAAGCTGTGGAGCGGTATTCGTCTCAAATGGTGCTGCTCAACGGAAGTGAA
AACAATCTGTTCGACCGGCTGGACGAGCATGCTCGGCAGAATGCACCACACGGCGGATAC
GGCGAGACGACCTGGCCGGTCGTCCGCAGCGACGACAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [11-172]  3.09999999999998e-22 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [6-268]  4.79998722798115e-42 SSF102588
SSF102588   SSF102588
 [9-253]  3.7e-28 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   G3DSA:3.40.50.10320
SignalP No significant hit
TMHMM No significant hit