close all open/close all

CDS information : Teicp_00190


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction44,746 / 46,692 / + [in whole cluster]
44,746 / 46,692 / + [in contig]
Location44746..46692 [in whole cluster]
44746..46692 [in contig]
TypeCDS
Length1,947 bp (648 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)ABC transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZI9
NITE
Teicp2_00250
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q799B1
NITE
Balhi_00060
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [ABC transporter]
MDVVLRFGGVSKNDDDPDPWQTLIGPGTLRRVLAYFRPHIGKVALFVLVAALESLVVVVV
PLLLMELVNGGILKDDAGVVASMAGLAAGLALVGALLQLVSAYISGQIGQGVSYDLRVQA
LRHVQQLPIAFFTRTQTGVLVGRLHTELIMAQQAFSQLLMAATSAVTVILVMAELFYLSW
LVAVVTLVLIPLFLVPWIYVGRVIRRRTGRLMDANTGLGGLLQERFNVQGAMLSKLFGRP
REEMAEYADRAERIRRIGVSLSVYGRLAFVMMALMASLATALVYGIGGGLVLAGAFQLGT
LVALATLLGRLFGPITQLSGMQETAQTVVVSFSRIFEVLDLKGLIEERPGAVALAKDTAP
EIEFDDVAFRYPTADEVSLRSLEYVRAERERGETTPEVLRGVSLHVPAGTLTALVGPSGA
GKSTLTHLVSRLYDPTGGVIRVGGHDLRDLTFDSLREAVGVVSQDAYFFHDTIRQNLLYA
RPTATEDELIEACRGAQIWDLIASLPGGFDTVTGDRGYRLSGGEKQRLAIARLLLKAPTI
VVLDEATAHLDSESEAAVQRALKTALHNRTSLVIAHRLSTIREADQILVIDDGRVRERGT
HDELLAEGGLYAELYHTQFAKAGSDAAEPASDAAELHHREPEPVHGGG
selected fasta
>putative ABC transporter ATP-binding/permease protein [ABC transporter]
GTGGACGTGGTGTTGCGCTTCGGGGGGGTGTCGAAGAACGATGACGACCCCGATCCCTGG
CAGACCCTGATCGGGCCGGGGACGCTGCGCAGAGTGCTCGCCTACTTCCGCCCGCACATC
GGCAAGGTGGCGCTCTTCGTTCTCGTCGCCGCGCTGGAGTCGCTTGTCGTCGTCGTAGTT
CCGTTGTTGCTGATGGAACTGGTCAACGGCGGCATCCTCAAGGACGACGCCGGGGTCGTG
GCATCGATGGCCGGCCTGGCCGCCGGCCTCGCCCTGGTGGGCGCGCTGTTGCAGCTGGTG
TCAGCCTATATTTCCGGGCAGATCGGGCAGGGGGTCAGCTACGACCTCCGGGTTCAGGCG
CTGCGTCACGTTCAGCAGCTGCCGATCGCGTTCTTCACCCGTACCCAGACCGGGGTGCTG
GTGGGCCGGCTGCACACGGAACTGATCATGGCGCAGCAGGCGTTCAGCCAGCTCCTGATG
GCAGCCACCAGCGCCGTCACGGTGATCCTGGTGATGGCCGAGCTGTTCTACCTGTCATGG
CTTGTCGCCGTGGTCACCCTGGTGCTGATTCCGCTGTTCCTCGTGCCCTGGATCTACGTG
GGCCGGGTGATCCGGCGGCGCACCGGACGGCTGATGGACGCGAATACCGGCCTTGGTGGA
CTCCTCCAGGAGCGGTTCAACGTTCAGGGGGCGATGCTCTCCAAACTCTTCGGCCGTCCC
CGCGAGGAGATGGCCGAGTACGCCGATCGTGCCGAGCGCATCCGCCGCATCGGCGTGAGT
CTCTCGGTGTACGGGCGGCTCGCCTTCGTCATGATGGCGCTGATGGCCTCGCTCGCCACG
GCGCTCGTCTACGGCATCGGTGGCGGGCTCGTGCTCGCCGGGGCGTTCCAGCTCGGCACG
CTCGTCGCCCTCGCCACTCTGCTCGGGCGGTTGTTCGGGCCGATCACGCAGCTGTCCGGG
ATGCAGGAAACCGCGCAGACCGTCGTGGTGAGCTTCTCCCGGATCTTCGAGGTGCTCGAT
CTGAAGGGGCTGATCGAGGAGCGTCCCGGTGCGGTCGCGCTCGCCAAGGACACGGCGCCG
GAGATCGAGTTCGACGACGTGGCGTTCCGCTATCCGACCGCCGACGAGGTCTCGCTGCGC
TCGCTGGAGTACGTACGCGCCGAACGGGAGCGCGGGGAGACGACGCCGGAGGTGCTGCGC
GGTGTCAGCCTGCACGTGCCGGCCGGCACCCTCACCGCGCTCGTCGGCCCGTCCGGCGCC
GGCAAGAGCACGCTCACCCACCTGGTGTCACGGCTGTACGACCCGACCGGCGGGGTCATT
CGCGTCGGTGGGCACGATCTGCGCGACCTCACCTTCGACTCGCTGCGCGAAGCGGTGGGC
GTGGTCAGCCAGGACGCCTACTTCTTCCACGACACGATCCGGCAGAACCTGCTCTACGCC
CGCCCCACCGCCACCGAGGACGAACTGATCGAGGCATGTCGAGGGGCCCAGATCTGGGAC
CTGATCGCCTCGCTCCCGGGCGGGTTCGACACCGTCACCGGCGATCGTGGCTACCGCCTG
TCGGGCGGCGAGAAGCAACGCCTGGCCATCGCCCGGCTGCTGCTGAAGGCGCCGACGATC
GTCGTGCTCGACGAAGCCACCGCTCACCTGGACTCCGAGTCCGAGGCCGCCGTGCAGCGG
GCACTCAAGACCGCCCTGCACAACCGCACCTCGTTGGTGATCGCCCACCGGTTGTCCACG
ATTCGCGAGGCCGACCAGATCCTCGTGATCGACGACGGACGGGTCCGGGAGCGCGGAACG
CACGACGAGCTGCTGGCCGAGGGGGGTCTGTACGCGGAGCTTTACCACACGCAGTTCGCC
AAGGCCGGAAGCGACGCAGCCGAACCGGCGAGCGACGCAGCCGAGCTGCACCACAGGGAG
CCCGAGCCGGTGCACGGCGGAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [46-314]  4.6e-21 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [379-617]  PS50893
PS50893   ABC_TRANSPORTER_2
 [423-548]  8.19999999999997e-22 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [408-594]  1.20000117458134e-18 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [16-349]  2.99998750445706e-62 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [520-534]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-327]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [43-65]  Transmembrane (i-o) [80-102]  Transmembrane (o-i) [154-173]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [263-285]  Transmembrane (i-o) [290-312]  Transmembrane (o-i)
Transmembrane 6