close all open/close all

CDS information : Teicp_00200


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction47,098 / 48,273 / + [in whole cluster]
47,098 / 48,273 / + [in contig]
Location47098..48273 [in whole cluster]
47098..48273 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase
GeneoxyA
Gene (GenBank)
EC number
Keyword
  • 3rd cross-linking
  • D-O-E ring
Note
Note (GenBank)
  • ORF5*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[26820384] Structure of OxyA tei: completing our picture of the glycopeptide antibiotic producing Cytochrome P450 cascade. (FEBS Lett. , 2016)
Related Reference
ACC
Q6ZZI8
NITE
Teicp2_00270
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
ACC
Q8KLL7
NITE
A4793_00090
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase]
MFEEINVVRAAELHRRDRFDPVPQLRSLMAEGPLTTLGTEESPGGRTAWLATGYDEIRQV
LSSDDFSARLLYGGTAAGITWPGFLTQYDPPEHTRLRRMVAPAFAVRRMQKFQPQVERVV
QDSLDAIEALGGPVDFVPRFGWSVATTATCDFLGIPRDDQADLARSLHASRTERSGKRRT
AAGNKFMTYMNKMTARTRRDPGDDMFGVVVREYGDEITDAELTGVAAFVMGAGADQVARF
LAAGAWLMADDPEQFALLREKPDTVPDWLDEVIRYLTTDEKTHPRVATDDVRIGDHLIKA
GDTVTCSLLAANRRNFPRPEDRFDITRVRPEHLAFGHGIHHCLGRSLAELVFRTAIPALA
HRFPTLRLAEPHREIRLGPPPFDVEALLLDW
selected fasta
>cytochrome P450 [P450 monooxygenase]
ATGTTCGAGGAGATCAACGTTGTCCGGGCCGCGGAGCTGCACCGGAGGGACCGATTCGAT
CCGGTGCCACAGCTGCGCTCGCTGATGGCCGAGGGCCCGTTGACCACGCTGGGCACCGAG
GAGTCTCCCGGAGGCCGGACGGCGTGGCTCGCCACCGGGTACGACGAGATCCGGCAGGTT
CTCAGCTCCGACGACTTCAGCGCACGGCTGCTCTACGGGGGAACCGCTGCCGGCATCACC
TGGCCCGGTTTCCTCACCCAGTACGACCCGCCCGAGCACACCCGACTGCGCCGCATGGTG
GCGCCCGCCTTCGCCGTCCGACGGATGCAGAAGTTCCAGCCGCAGGTCGAGCGGGTCGTC
CAGGACAGTTTGGACGCCATCGAGGCGCTCGGCGGACCGGTCGACTTCGTCCCCCGTTTC
GGGTGGTCGGTGGCGACGACGGCGACCTGCGACTTCCTCGGCATTCCGCGCGACGATCAG
GCGGATCTGGCGCGCAGCCTCCATGCCAGCCGAACCGAACGGTCAGGCAAGCGGCGTACC
GCGGCAGGCAACAAGTTCATGACGTACATGAACAAGATGACGGCTCGCACCCGCCGCGAT
CCCGGTGACGACATGTTCGGTGTCGTGGTACGCGAGTACGGCGACGAGATCACCGACGCG
GAGCTGACCGGCGTCGCCGCGTTCGTCATGGGCGCGGGCGCCGACCAGGTGGCCCGTTTC
CTCGCGGCCGGCGCGTGGCTGATGGCCGACGATCCCGAGCAGTTCGCACTGCTGCGGGAG
AAGCCGGACACCGTCCCGGATTGGCTGGACGAGGTGATTCGGTATCTGACCACCGATGAG
AAGACCCATCCGCGCGTCGCGACGGACGACGTGCGCATCGGCGATCACCTCATCAAGGCC
GGCGATACCGTCACGTGCTCCCTGCTGGCTGCCAACCGCCGCAACTTCCCGCGCCCGGAG
GATCGATTCGACATCACCCGGGTCCGGCCGGAGCACCTGGCGTTCGGGCACGGCATCCAT
CACTGCCTGGGCAGGTCTCTGGCCGAGCTGGTGTTCCGGACGGCGATTCCGGCCCTGGCA
CACCGCTTCCCCACGCTGAGGCTGGCCGAGCCGCACCGAGAGATCAGATTGGGGCCGCCG
CCGTTCGACGTGGAAGCCCTGCTGCTCGACTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [14-378]  6.20000000000009e-81 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [269-363]  9e-11 PF00067
PF00067   p450
 [18-391]  4.69998262513189e-74 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  2.80000504261099e-34 PR00359 [135-151]  2.80000504261099e-34 PR00359 [152-167]  2.80000504261099e-34 PR00359 [188-210]  2.80000504261099e-34 PR00359 [267-278]  2.80000504261099e-34 PR00359 [285-312]  2.80000504261099e-34 PR00359 [333-342]  2.80000504261099e-34 PR00359 [342-353]  2.80000504261099e-34 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [335-344]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit