close all open/close all

CDS information : Teicp_00210


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction48,296 / 49,450 / + [in whole cluster]
48,296 / 49,450 / + [in contig]
Location48296..49450 [in whole cluster]
48296..49450 [in contig]
TypeCDS
Length1,155 bp (384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase
GeneoxyE
Gene (GenBank)
EC number
Keyword
  • 2nd cross-linking
  • F-O-G ring
Note
Note (GenBank)
  • ORF6*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[20974107] Structural characterization of CYP165D3, a cytochrome P450 involved in phenolic coupling in teicoplanin biosynthesis. (Arch Biochem Biophys. , 2011)
[21445994] Crystal structure of a phenol-coupling P450 monooxygenase involved in teicoplanin biosynthesis. (Proteins. , 2011)
Related Reference
ACC
Q6ZZI7
NITE
Teicp2_00280
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
ACC
Q8KLL8
NITE
A4793_00080
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase]
MALPLPHQRLRLDPVPEFEELQKAGPLHEYDTEPGMDGRKQWLVTGHDEVRAILADHERF
SSMRPVDDEADRALLPGILQAYDPPDHTRLRRTVAPAYSARRMERLRPRIEEIVEECLDD
FESVGAPVDFVRHAAWPIPAYIACEFLGVPRDDQAELSRMIRESRESRLPRQRTLSGLGI
VNYTKRLTSGKRRDPGDGMIGVIVREHGAEISDEELAGLAEGNLIMAAEQMAAQLAVAVL
LLVTHPDQMALLREKPELIDSATEEVLRHASIVEAPAPRVALADVRMAGRDIHAGDVLTC
SMLATNRAPGDRFDITREKATHMAFGHGIHHCIGAPLARLQLRVALPAVVGRFPSLRLAV
PEEDLRFKPGRPAPFAVEELPLEW
selected fasta
>cytochrome P450 [P450 monooxygenase]
ATGGCACTTCCTCTGCCGCATCAGCGGCTCCGGCTCGATCCGGTGCCGGAGTTCGAAGAG
CTGCAAAAAGCTGGGCCCCTGCACGAATACGACACCGAGCCGGGCATGGACGGCCGTAAG
CAGTGGCTGGTCACCGGACATGACGAGGTCCGCGCGATCCTCGCCGACCACGAGCGGTTC
AGTTCCATGCGGCCGGTCGACGACGAGGCGGATCGCGCCCTGTTGCCGGGAATCCTGCAG
GCGTACGACCCGCCGGATCACACCCGGCTGCGCAGGACGGTGGCCCCGGCGTATTCCGCC
CGACGGATGGAGCGGCTGCGACCCCGCATCGAGGAGATCGTCGAAGAGTGCTTGGACGAC
TTCGAGAGCGTGGGCGCGCCGGTCGACTTCGTCCGACATGCCGCCTGGCCCATCCCCGCG
TACATCGCCTGCGAATTCCTCGGCGTCCCGCGTGACGACCAGGCGGAGTTGTCGCGGATG
ATCAGGGAGAGCCGGGAGAGTCGGCTTCCCCGGCAGCGGACCCTGTCGGGTCTGGGCATC
GTCAATTACACCAAGCGGTTGACCTCCGGCAAACGCCGTGATCCTGGCGACGGGATGATC
GGCGTGATCGTGCGCGAACACGGCGCTGAGATCAGCGACGAGGAATTGGCGGGGCTCGCC
GAGGGGAACCTGATCATGGCGGCGGAGCAGATGGCCGCGCAGCTGGCGGTCGCGGTGCTC
CTGCTGGTGACCCACCCCGACCAGATGGCGCTGCTGCGCGAGAAACCGGAGCTCATCGAC
AGCGCCACCGAGGAAGTGCTGCGCCACGCGTCCATCGTCGAGGCCCCGGCTCCCCGGGTG
GCGCTCGCTGACGTGCGCATGGCCGGACGCGACATCCATGCCGGCGATGTCCTGACGTGT
TCCATGCTGGCGACCAATCGCGCCCCGGGAGATCGGTTCGACATCACCCGGGAGAAAGCC
ACCCACATGGCATTCGGACACGGCATCCACCACTGTATCGGGGCGCCGCTGGCCCGGCTC
CAGCTGCGGGTGGCGCTGCCGGCGGTGGTCGGCCGGTTCCCGTCTTTGCGGCTGGCGGTC
CCGGAGGAGGACCTGCGGTTCAAACCGGGCAGGCCGGCACCCTTCGCGGTAGAGGAGCTT
CCCCTTGAGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11-384]  1.19999063421924e-77 SSF48264
SSF48264   Cytochrome_P450
 [257-353]  8.40000000000001e-11 PF00067
PF00067   p450
 [9-384]  9.3000000000001e-87 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [82-93]  1.50000306971104e-30 PR00359 [129-145]  1.50000306971104e-30 PR00359 [146-161]  1.50000306971104e-30 PR00359 [182-204]  1.50000306971104e-30 PR00359 [261-272]  1.50000306971104e-30 PR00359 [323-332]  1.50000306971104e-30 PR00359 [332-343]  1.50000306971104e-30 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [325-334]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit