close all open/close all

CDS information : Teicp_00220


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction49,440 / 50,636 / + [in whole cluster]
49,440 / 50,636 / + [in contig]
Location49440..50636 [in whole cluster]
49440..50636 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase
GeneoxyB
Gene (GenBank)
EC number
Keyword
  • 1st cross-linking
  • C-O-D ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • ORF7*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[25358800] Cytochrome P450 OxyBtei catalyzes the first phenolic coupling step in teicoplanin biosynthesis. (Chembiochem. , 2014)
Related Reference
ACC
Q70AY8
NITE
Teicp2_00290
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
ACC
Q8KLL9
NITE
A4793_00070
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase]
MSGDGSPPIHTRRQGFDPADELRAAGTLTKISIGSGADAETTWLAAGHAVVRQVLGDHKR
FSTRRRFDRRDEIGGTGVFRPRELVGNLMDYDPPEHTRLRHLLTPGFTQRRMRRLAPRIE
EIVTDRLDAMEQAGPPADLIELFADEVPGAVLCELIGVPRDDQAMFLQLCHRHLDASLSA
RKRAAAGEAFARYLVAMMARERKDPGDGFIGSIVAEHGDTITDEELRGVCVQLMLAGDDN
VSGMIGLGVLALLRHPEQIAALRGDDQSADRAVDELIRYLTVPYAPTPRTAVEDVMVADQ
VIKEGETVLCSLPMANRDRALLPDADRLDVTRTPVPHVAFGHGIHHCLGAALTRLQLRIA
YTALWRRFPALQLADPAQEIMFRTSTPAYGLTSLLVAW
selected fasta
>cytochrome P450 [P450 monooxygenase]
TTGAGTGGTGACGGCTCGCCTCCGATCCACACCCGCCGGCAGGGTTTCGATCCGGCCGAC
GAACTGCGCGCCGCCGGAACGCTGACGAAGATTTCCATCGGCTCCGGAGCGGACGCCGAG
ACCACCTGGCTGGCGGCCGGGCACGCCGTCGTGCGCCAGGTTCTGGGCGATCACAAGCGA
TTCAGCACCCGGCGCCGCTTCGACCGACGTGACGAGATCGGCGGGACGGGCGTCTTCCGC
CCGCGTGAGCTGGTCGGCAACCTGATGGACTACGACCCACCGGAGCACACCCGGCTCCGG
CACCTGCTGACCCCGGGATTCACCCAGCGCCGGATGCGTCGTCTGGCGCCGCGCATCGAA
GAGATCGTGACCGACCGCCTCGACGCCATGGAGCAGGCGGGGCCGCCGGCGGACCTGATC
GAGCTGTTCGCCGACGAGGTGCCCGGAGCCGTGCTGTGCGAGCTGATCGGAGTACCCCGC
GACGATCAGGCCATGTTCCTGCAGCTGTGTCACCGGCATCTCGACGCCTCGCTGAGTGCC
AGGAAACGGGCGGCCGCCGGGGAGGCGTTCGCCCGCTACCTGGTGGCCATGATGGCCAGG
GAACGCAAGGACCCCGGCGACGGGTTCATCGGCTCGATCGTCGCCGAACACGGCGACACG
ATCACGGATGAGGAGCTGAGAGGCGTCTGTGTGCAGCTGATGCTGGCCGGTGACGACAAC
GTCTCCGGCATGATCGGGCTGGGGGTGCTGGCGTTGCTGCGACATCCCGAGCAGATCGCC
GCGTTGCGCGGGGACGATCAGTCGGCGGATCGAGCTGTCGACGAGCTGATCCGGTACCTG
ACGGTCCCATACGCCCCGACACCGCGGACCGCCGTGGAGGACGTCATGGTTGCCGACCAG
GTGATCAAGGAGGGCGAGACGGTTCTCTGCTCTCTCCCGATGGCCAACCGTGACCGCGCC
CTGCTGCCGGATGCCGACCGCCTCGACGTGACCCGTACGCCCGTTCCGCATGTCGCGTTC
GGACACGGTATCCATCACTGTCTGGGCGCCGCTCTGACGCGCCTGCAACTGCGAATCGCC
TATACCGCCCTGTGGCGGCGCTTTCCCGCTTTGCAACTGGCGGACCCCGCCCAGGAAATA
ATGTTCCGGACGAGTACCCCGGCGTATGGATTAACCAGTCTGCTGGTTGCCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [20-398]  2.30000000000004e-90 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [5-398]  1.3000049540733e-85 SSF48264
SSF48264   Cytochrome_P450
 [215-368]  2e-13 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  2.50000909916183e-49 PR00359 [138-154]  2.50000909916183e-49 PR00359 [155-170]  2.50000909916183e-49 PR00359 [192-214]  2.50000909916183e-49 PR00359 [271-282]  2.50000909916183e-49 PR00359 [289-316]  2.50000909916183e-49 PR00359 [317-332]  2.50000909916183e-49 PR00359 [338-347]  2.50000909916183e-49 PR00359 [347-358]  2.50000909916183e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit