close all open/close all

CDS information : Teicp_00230


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction50,931 / 52,406 / + [in whole cluster]
50,931 / 52,406 / + [in contig]
Location50931..52406 [in whole cluster]
50931..52406 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF8*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AY7
NITE
Teicp2_00300
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q7WZ81
NITE
A4092_00160
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
ACC
G4V4R7
NITE
Vanco_00150
PmId
[24756572] Bis-chlorination of a hexapeptide-PCP conjugate by the halogenase involved in vancomycin biosynthesis. (Org Biomol Chem. , 2014)
ACC
R4T052
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative halogenase [halogenase]
MPVEEFDVVVAGGGPAGSTVATLVAMQGHRVLLLEKETFPRYQIGESLLPSTVHGVCRML
GVSDELAAAGFPVKRGGTFRWGARPEPWTFSFAVSPLMNGPTSFAYQVERARFDEILLRN
AQRKGVDVREGCSVTGVIEGDERITGVRYTDPDGGEHEVSARFVVDASGNKSRLYSQVGG
VRNYSEFFRSLALFGYFENGKRLPEPYSGNILSVAFDSGWFWYIPLSDTMTSVGAVVRRE
MAEKIQGDREKALQALIAECPLISDYLADARRITTGRYGELRVRKDYSYHQTSYWRPGMI
LVGDAACFVDPVFSSGVHLATYSALLAARSINSVLAEDLDEKTALSEFEARYRREYGVFY
EFLVSFYQMNVNEESYFWQAKKVTNNKHTEIESFVELIGGVSSGEAALATAGRIAERSAE
FAAAVDQMAASADGNMVPMYKSEVVKQVMQEGGQVQMKAVLGADAEPELPLFPGGLVVSP
DGMKWLPYRPA
selected fasta
>putative halogenase [halogenase]
ATGCCGGTGGAAGAGTTCGACGTGGTGGTGGCCGGTGGCGGGCCGGCCGGTTCGACCGTG
GCCACGCTGGTGGCCATGCAGGGCCATCGGGTGCTGCTGCTGGAGAAGGAGACCTTCCCC
CGGTACCAGATCGGCGAGTCGTTGCTGCCCTCCACCGTCCACGGGGTGTGCCGGATGCTC
GGCGTCTCGGACGAGCTGGCGGCAGCCGGCTTCCCCGTCAAGCGCGGCGGCACCTTCCGC
TGGGGCGCCCGCCCGGAGCCGTGGACGTTCTCCTTCGCCGTCTCGCCCCTGATGAACGGC
CCGACGTCGTTCGCGTACCAGGTCGAACGGGCGCGCTTCGACGAGATCCTGCTGCGTAAC
GCGCAGCGCAAGGGCGTCGACGTGCGCGAGGGATGCTCGGTCACCGGGGTGATCGAAGGC
GACGAGCGGATCACCGGGGTGCGTTACACCGACCCCGACGGCGGCGAGCACGAGGTGTCG
GCGCGGTTCGTGGTCGACGCGTCGGGCAACAAGAGCCGGCTGTACTCCCAGGTCGGCGGC
GTCCGCAACTATTCGGAGTTCTTCCGCAGCCTGGCGCTGTTCGGTTACTTCGAGAACGGC
AAGCGGCTGCCGGAGCCGTACTCGGGCAACATCCTGAGCGTCGCGTTCGACAGCGGCTGG
TTCTGGTACATCCCGCTGAGCGACACGATGACCAGCGTCGGCGCGGTGGTGCGCCGGGAG
ATGGCGGAGAAGATCCAGGGCGACCGGGAGAAGGCGCTCCAGGCCCTGATCGCCGAATGC
CCGCTGATCTCCGACTACCTCGCCGACGCGCGCCGGATCACCACCGGCCGGTACGGAGAA
CTGCGGGTCCGCAAGGACTACTCGTATCACCAGACCAGCTACTGGCGGCCCGGGATGATC
CTGGTCGGGGACGCCGCGTGCTTCGTGGACCCGGTGTTCTCCTCGGGCGTGCACCTGGCG
ACCTACAGCGCGCTGCTGGCGGCGCGGTCGATCAACAGCGTGCTCGCCGAGGACCTGGAC
GAGAAGACCGCGCTGAGTGAGTTCGAGGCCCGCTACCGCCGCGAGTACGGGGTGTTCTAC
GAGTTCCTGGTGTCCTTCTACCAGATGAACGTCAACGAGGAGTCGTACTTCTGGCAGGCC
AAGAAGGTCACCAACAACAAGCACACCGAGATCGAGTCGTTCGTGGAGCTGATCGGCGGG
GTGTCGTCGGGTGAGGCGGCGCTGGCCACGGCCGGCCGGATCGCCGAGCGCAGCGCCGAG
TTCGCCGCGGCCGTGGACCAGATGGCCGCCAGCGCCGACGGCAACATGGTGCCGATGTAC
AAGTCGGAAGTGGTCAAGCAGGTGATGCAGGAGGGCGGCCAGGTGCAGATGAAGGCGGTG
CTCGGCGCGGACGCCGAGCCCGAGCTGCCGCTGTTCCCCGGCGGGCTGGTGGTCTCGCCC
GACGGGATGAAGTGGCTGCCCTACCGTCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  3.6000003870074e-08 PR00420 [160-175]  3.6000003870074e-08 PR00420 [296-311]  3.6000003870074e-08 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [7-94]  1.99999999999999e-25 PF04820 [100-426]  1.60000000000002e-83 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit