close all open/close all

CDS information : Teicp_00240


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction52,514 / 53,746 / + [in whole cluster]
52,514 / 53,746 / + [in contig]
Location52514..53746 [in whole cluster]
52514..53746 [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450 monooxygenase
GeneoxyC
Gene (GenBank)
EC number
Keyword
  • 4th cross-linking
  • AB ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • ORF9*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AY6
NITE
Teicp2_00310
PmId
[11386360] Teicoplanin biosynthesis genes in Actinoplanes teichomyceticus. (Antonie Van Leeuwenhoek. , 2000)
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
ACC
Q8KLM1
NITE
A4793_00050
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 monooxygenase]
MDHDIDEVAPVVEPTANYMRRTVCDPHEDMFALRAHGPLIRIGGDAAVQMGADYLWQAMG
YDVVRQILGDHENFTTRLRLTASEPISGEGATKPQELVGQISTYDPPEHTRLRRMLTPEF
TVRRVRRLEPAIQELIDDRIDAMEAAGPPVDVQTVFADPVGGGALCELLGIPRDDRNQFM
RRVRQNVDLSRGYKARAADSAAFNRYLQSLITRQRKDPDEGFLGMLVRDHGDDITDEELK
GVCTALLLGGVETVAGMLGFGVLALLDHPDQRRLLFAGREEADRLVNELLRYLSAVQQPT
PRMAVKDVVVDGQQIRAGEYVLCSILMANRDEALTPHPNVLDAEREPAPHIGFGHGIHHC
IGAAVARTVLRMAYQTLWRRLPGLRLAIPAGQVKLRNAFIDSPDQLPVTW
selected fasta
>putative cytochrome P450 [P450 monooxygenase]
ATGGATCACGACATCGATGAGGTCGCGCCGGTCGTGGAGCCGACGGCGAACTACATGAGG
AGAACGGTCTGCGACCCGCACGAGGACATGTTCGCTCTGCGGGCGCACGGTCCGCTGATC
CGGATCGGCGGGGATGCCGCGGTCCAGATGGGCGCGGATTATCTCTGGCAGGCGATGGGC
TACGACGTCGTGCGGCAGATCCTCGGTGATCATGAGAACTTCACGACGCGGCTGCGGCTG
ACCGCGTCCGAACCGATCAGCGGGGAAGGCGCGACCAAACCGCAGGAGCTGGTCGGACAG
ATCTCGACCTACGATCCGCCCGAGCACACCCGCCTGCGCCGGATGCTCACGCCGGAGTTC
ACGGTCCGGCGCGTCCGCCGGCTGGAGCCCGCGATCCAGGAGCTCATCGACGACCGCATC
GATGCGATGGAGGCCGCGGGACCGCCCGTGGACGTGCAGACGGTCTTCGCCGATCCGGTC
GGCGGCGGCGCGCTGTGCGAACTGCTCGGCATCCCACGCGATGATCGGAACCAGTTCATG
CGCCGGGTCCGGCAGAACGTCGATCTCAGCCGCGGATACAAGGCCCGGGCGGCCGACAGC
GCGGCGTTCAACCGGTACCTGCAGAGCCTCATCACCCGGCAGCGCAAGGACCCCGACGAG
GGGTTCCTCGGCATGCTGGTGCGCGACCACGGCGACGACATCACGGACGAGGAGCTCAAG
GGCGTGTGCACGGCGCTGCTCCTCGGCGGTGTCGAGACCGTCGCGGGGATGCTGGGCTTC
GGGGTCCTCGCGCTGCTGGACCATCCCGACCAGAGGCGGCTGCTCTTCGCCGGCCGCGAG
GAGGCCGACCGCCTGGTCAACGAACTGTTGCGGTATCTGTCGGCGGTGCAGCAGCCGACT
CCGCGGATGGCCGTCAAGGACGTGGTCGTCGATGGGCAACAGATCAGGGCGGGGGAGTAC
GTGCTGTGCTCGATCCTCATGGCCAACCGGGACGAAGCGCTGACACCCCATCCCAACGTT
CTGGACGCGGAGCGTGAGCCGGCGCCACACATCGGATTCGGGCACGGCATCCATCACTGC
ATCGGGGCGGCGGTGGCGAGAACCGTGCTGCGGATGGCCTACCAGACCCTGTGGCGACGA
CTTCCCGGGCTGCGCCTCGCGATACCCGCCGGGCAGGTGAAGCTCAGGAACGCGTTCATC
GACAGTCCGGATCAGTTGCCGGTCACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [205-377]  3.9e-15 PF00067
PF00067   p450
 [9-410]  5.5e-95 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [10-410]  1.1e-89 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [104-115]  3.6e-44 PR00359 [151-167]  3.6e-44 PR00359 [168-183]  3.6e-44 PR00359 [205-227]  3.6e-44 PR00359 [284-295]  3.6e-44 PR00359 [302-329]  3.6e-44 PR00359 [330-345]  3.6e-44 PR00359 [351-360]  3.6e-44 PR00359 [360-371]  3.6e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [353-362]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit