close all open/close all

CDS information : Teicp_00260


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction55,229 / 56,206 / + [in whole cluster]
55,229 / 56,206 / + [in contig]
Location55229..56206 [in whole cluster]
55229..56206 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductN-acyltransferase
Product (GenBank)acyltransferase
Gene
Gene (GenBank)
EC number2.3.1.-
Keyword
  • N-acyl-glucosamine moiety
Note
Note (GenBank)
  • ORF11*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[25095906] Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus. (J Am Chem Soc. , 2014)
[27285718] Characterization of the Post-Assembly Line Tailoring Processes in Teicoplanin Biosynthesis. (ACS Chem Biol. , 2016)
Related Reference
ACC
Q70AY4
NITE
Teicp2_00330
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[15664522] Tailoring of glycopeptide scaffolds by the acyltransferases from the teicoplanin and A-40,926 biosynthetic operons. (Chem Biol. , 2005)
[17661468] Kinetic analysis of teicoplanin glycosyltransferases and acyltransferase reveal ordered tailoring of aglycone scaffold to reconstitute mature teicoplanin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>N-acyltransferase [acyltransferase]
MMMDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEI
VAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLAT
VPAVRRFHAERGIPDEVGWETLSRLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGR
LQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWM
LDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSS
LERAVIAHLKAGRHWHMRTGFVKLP
selected fasta
>N-acyltransferase [acyltransferase]
GTGATGATGGATCCCGAGACCGTACGCATCGCGCTGGGGTTGGAGGAACGGACCGCGGCG
TGGCTCACCGAGCTCGATGAGCTCGGTCCGCCCGCCGAGCCGGTACGGCTGCCGCGCGGC
GAGGAGGCACGTGATCTGCTACGGCGTCTGGAGGTGCCGGAGCTCGACGCCGAGGAGATC
GTGGCGGCCGCTCCCGATCCGGATCGTGACCCGGCCCTGTGGTGGCTGCTCGAACGCACC
CACCACGCGATCGTCCGGCACATGGGCGACCACCGGGCGAAGCCACGCGGCGGTCCGCCC
CTGCCGTACGAGGGCGGCGCCGCCGCACGCTACTTCCACGTGTACGTCTTCCTCGCGACG
GTGCCGGCGGTGCGCCGCTTCCACGCGGAACGGGGTATCCCCGACGAGGTCGGCTGGGAG
ACCCTGAGCAGGTTGGGGGAGCTGGTGGCCATTCATCGCCGCAAGTACGGCCAGGGCGGC
ATGAACATGCAGTGGTGGACCACCTACCACCTGCGCGGCATCCTCTACCGGCTCGGCCGC
CTGCAATTCAGTCTGGCCACCGGAAAGGACGGCACGCCGCACCTCGGCCTGCACGTTCCC
GAGTGGGGCGGACCGCTGTTGCCCAAGGCCTATGACGAATCGTTGCATCGTGCCCGCCCG
TTCTTCGACCGGCATTTTCCCGAGCACGGCGCCCGGGTGGCCTGGGGAAGCTCGTGGATG
CTCGATCCGCAACTGGAGGAGTATCTCACCGAGGACTCCAACATCATTCAGCTTGCGCGG
TTCTGGACGCTCACCGACTCCGCGCCGGAGCCCGGTAACGCGGACGGGGACTCCTCGATC
CTGGAGTTCGTGTTCCGCTACAACGGCCAGCCGCTGGATGAACTTCCGCAGCGTTCCTCG
CTGGAGCGCGCGGTGATCGCCCATCTGAAGGCCGGACGTCACTGGCACATGCGGACCGGC
TTCGTGAAGCTGCCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit