close all open/close all

CDS information : Teicp_00270


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction56,350 / 57,942 / + [in whole cluster]
56,350 / 57,942 / + [in contig]
Location56350..57942 [in whole cluster]
56350..57942 [in contig]
TypeCDS
Length1,593 bp (530 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)b-hydroxylase
Gene
Gene (GenBank)
EC number
Keyword
  • Bht
Note
Note (GenBank)
  • ORF12*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZI1
NITE
Teicp2_00340
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q7WZ63
NITE
A4092_00340
PmId
[16499611] A derivative of the glycopeptide A40926 produced by inactivation of the beta-hydroxylase gene in Nonomuraea sp. ATCC39727. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative hydroxylase [b-hydroxylase]
MNEERLFLRPNTIIEPLVDRFYASMYATAPVTATMSLAFRWIPMLESYLQAPEWHYKGSR
DPKFRGGFFVNIEDSRADEVRALLAAIRRDRADMIRFAEAIAEAEKIVREEATGYDLRPL
YPKLPAELAGLVEIAYDTSNAASLHFQEPLVYHSKAYTEQRQSVQLSVETGIERPFVMST
PRLPSPDVLELPIPFRHPGLEQLFLSRIRPTTLTALREALELGDSQAAQLAGLLVPEPAL
AADRHIAAGARIRYWGHACLLMQTPDVAIMTDPFISADTDATGRYTYNDLPDRIDYVLIT
HGHSDHLVPETLLQLRGRVGTFVVPRTSRGNLCDPSLALYLKSFGFSAVEVDDFDEISFP
GGKIAATPFFGEHADLDIRAKATYWINLGGKSIYVGADSSGLDPALYRYVRRHLGRVDIA
FLGMECDGAPLNWQYQAFLTKPIPNKMSDSRKMSGSNAEQASAIVTELGADEVYIYAMGE
ESWLGHVMATSYNEDSFQLRQIAEFETWCANNGVKSGHLLDRHEWHWSHP
selected fasta
>putative hydroxylase [b-hydroxylase]
GTGAATGAGGAGCGCCTCTTTCTCCGGCCCAACACCATTATCGAGCCTCTGGTAGACAGA
TTTTATGCCTCGATGTACGCGACGGCTCCGGTCACGGCCACCATGAGTCTCGCGTTCCGG
TGGATTCCGATGCTGGAGTCCTACCTGCAGGCCCCGGAATGGCATTACAAGGGCAGCCGG
GACCCGAAGTTCCGCGGCGGGTTCTTCGTCAACATCGAGGACTCCCGGGCGGACGAGGTG
CGGGCGCTGCTCGCCGCGATCCGGCGCGACCGCGCCGACATGATCCGCTTCGCCGAGGCG
ATCGCGGAGGCCGAGAAGATCGTCCGGGAGGAGGCGACCGGGTACGACCTCCGGCCGCTC
TACCCGAAGCTGCCCGCCGAGCTGGCGGGCCTGGTGGAGATCGCCTACGACACCAGCAAC
GCCGCCTCGCTGCACTTCCAGGAGCCGCTGGTCTACCACAGCAAGGCCTACACCGAGCAG
CGGCAGTCGGTGCAGCTGTCCGTGGAGACCGGCATCGAGCGGCCGTTCGTGATGAGCACG
CCGCGGCTGCCCTCGCCGGACGTGCTGGAGCTGCCCATCCCGTTCCGGCACCCGGGCCTG
GAGCAGCTGTTCCTGTCCCGGATCCGGCCCACCACCCTGACCGCGCTGCGGGAGGCGCTG
GAACTCGGCGATTCGCAAGCGGCCCAGCTCGCCGGCCTGCTGGTCCCGGAGCCCGCGCTC
GCCGCGGACCGGCACATCGCGGCCGGCGCCCGGATCCGCTACTGGGGGCACGCCTGCCTG
CTCATGCAGACCCCGGACGTGGCCATCATGACCGACCCGTTCATCAGCGCGGACACCGAC
GCGACCGGCCGGTACACCTACAACGACCTGCCCGACCGCATCGACTACGTGCTGATCACC
CACGGGCACTCCGACCACCTCGTCCCGGAGACGCTGCTGCAGCTGCGCGGCCGGGTGGGC
ACGTTCGTGGTGCCGAGGACCTCCCGCGGCAATCTGTGCGACCCGTCGCTGGCGCTCTAC
CTCAAGAGCTTCGGGTTCTCCGCCGTCGAGGTGGACGACTTCGACGAGATCTCCTTCCCG
GGTGGCAAGATCGCGGCCACGCCGTTCTTCGGCGAGCACGCCGACCTGGACATCCGCGCC
AAGGCGACGTACTGGATCAACCTCGGCGGGAAGTCGATCTATGTGGGGGCGGACTCCTCC
GGCCTCGACCCGGCGCTCTACCGCTACGTCCGCCGGCACCTCGGGCGGGTCGACATCGCC
TTCCTCGGCATGGAGTGCGACGGCGCCCCGCTGAACTGGCAGTACCAGGCGTTCCTCACC
AAGCCGATCCCGAACAAGATGAGCGACAGCCGCAAGATGTCCGGCTCCAACGCGGAACAG
GCCAGCGCGATCGTCACCGAGCTCGGCGCCGACGAGGTGTACATCTACGCGATGGGCGAG
GAGAGCTGGCTCGGCCACGTCATGGCCACCAGCTACAACGAGGACTCCTTCCAGCTGCGG
CAGATCGCCGAGTTCGAGACCTGGTGCGCGAACAACGGGGTGAAGTCGGGCCACCTGCTC
GACCGGCACGAATGGCACTGGTCGCACCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [255-306]  1.3e-05 PF00753
PF00753   Lactamase_B
IPR019204 Domain of unknown function DUF2070, membrane (Domain)
 [312-490]  8.20000000000006e-38 PF09843
PF09843   DUF2070
SignalP No significant hit
TMHMM No significant hit