close all open/close all

CDS information : Teicp_00280


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction58,171 / 59,955 / + [in whole cluster]
58,171 / 59,955 / + [in contig]
Location58171..59955 [in whole cluster]
58171..59955 [in contig]
TypeCDS
Length1,785 bp (594 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative carboxylic acid--ACP ligase
putative acyl-ACP synthetase
Product (GenBank)Acyl-CoA synthase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF13*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[27285718] Characterization of the Post-Assembly Line Tailoring Processes in Teicoplanin Biosynthesis. (ACS Chem Biol. , 2016)
Related Reference
ACC
Q70AY2
NITE
Teicp2_00350
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q50E76
PmId
[18959760] Role of DptE and DptF in the lipidation reaction of daptomycin. (FEBS J. , 2008)
ACC
D2IKP9
PmId
[20081823] In vitro reconstruction of tetronate RK-682 biosynthesis. (Nat Chem Biol. , 2010)

close this sectionSequence

selected fasta
>putative carboxylic acid--ACP ligase [Acyl-CoA synthase]
MATAPDLVTLIRQHVAGRPDADAVGFLTDPDDIRGGVVSWTYGQLDREARGYAAWLQQRL
PAGSRVLLLYPNGLDFVAAFFGCLYAGMIAVPAPLPGRYRHHQHRVATISADARVSAVLT
TAAHLGEVRDWARACGLDHLLIAVGDEPEFGDPAGWTPASPERATIALLQYTSGSTGDPK
GVVVTHDNILYNLDACVRGLRWPDDWRVGGWLPLYHDLAMQGLLNMAVVRGGYALLMEPV
SFVRDPVRWLRTIAEHDIQVTFAPTFAYQLCLDRVTDEQLAALDLSGWKIAGNAAEPVNP
AILAAFAEKFAPAGFRPESFAPIYGMAEATGYISGEVGRAPLVRTVGLDALAHGRLADPA
PDEPVREIVSCGTPNEACDIRVVDPETSRVRPDGWLGEIWIRGRSVSPGYWSDAGPAFAA
VTAEGEDGFLRTGDLGVLQDGELYVHGRLKETFTVHGRHLYPHDVEQELRARHPELGKCG
AVFPGRAPGAGGARGVVVTHEVTNAARDRLPELAAGLRHTVGRAFGVEVSAVLLLRPGAV
LRTTSGKIRRSAMRELFHEGKLTALYQHPPAPREPLPYVGDPSPATRVTSLSRP
selected fasta
>putative carboxylic acid--ACP ligase [Acyl-CoA synthase]
ATGGCCACCGCACCCGATCTCGTAACTCTGATCCGTCAGCATGTCGCCGGGCGGCCGGAC
GCCGACGCCGTCGGCTTTCTCACCGACCCGGACGACATCCGCGGCGGGGTCGTGTCGTGG
ACCTACGGGCAGCTCGACCGGGAGGCTCGCGGGTACGCGGCCTGGTTGCAGCAGCGCCTG
CCCGCCGGCTCGCGGGTGCTGCTGCTGTATCCCAACGGGCTCGACTTCGTCGCGGCGTTC
TTCGGCTGCCTGTATGCCGGCATGATCGCGGTACCGGCGCCGCTGCCCGGCCGTTATCGC
CATCACCAACATCGGGTCGCGACCATCAGCGCCGATGCCCGGGTCAGCGCGGTCCTGACC
ACGGCGGCGCATCTGGGGGAGGTCCGCGACTGGGCTCGGGCGTGCGGACTGGACCACCTG
CTGATCGCGGTCGGCGACGAACCGGAGTTCGGCGATCCGGCGGGCTGGACGCCGGCGTCA
CCGGAACGTGCGACCATCGCGCTGTTGCAGTACACGTCCGGGTCGACCGGCGACCCGAAG
GGAGTCGTGGTCACCCACGACAACATCCTGTACAACTTGGATGCCTGCGTCCGGGGCCTG
CGCTGGCCGGACGACTGGCGGGTGGGCGGGTGGCTTCCGCTCTACCACGACCTGGCGATG
CAGGGGCTGCTCAACATGGCCGTCGTGCGCGGCGGCTATGCCTTGCTGATGGAGCCGGTC
TCGTTCGTGCGCGATCCGGTGCGCTGGCTGCGGACGATAGCCGAACACGACATCCAGGTG
ACGTTCGCGCCCACCTTCGCGTACCAACTGTGCCTCGACCGGGTCACCGACGAGCAGCTG
GCCGCTCTCGATCTGTCCGGCTGGAAGATCGCCGGGAACGCCGCGGAGCCGGTGAACCCG
GCGATCCTGGCCGCGTTCGCTGAGAAGTTCGCGCCGGCCGGGTTCCGCCCCGAGTCCTTC
GCGCCCATCTACGGGATGGCGGAGGCCACCGGCTACATCAGCGGGGAGGTGGGGCGTGCG
CCGCTGGTGCGTACCGTCGGCCTCGACGCGCTCGCCCATGGCCGGCTCGCCGACCCGGCG
CCGGACGAGCCGGTACGCGAAATCGTCAGCTGCGGCACTCCGAACGAGGCGTGCGACATC
CGTGTGGTGGACCCGGAGACGTCGCGCGTGCGGCCCGACGGGTGGTTGGGCGAGATCTGG
ATACGCGGGCGCAGCGTGTCCCCGGGCTACTGGAGCGATGCCGGGCCGGCCTTCGCCGCG
GTGACGGCCGAGGGGGAGGACGGCTTCCTGCGTACCGGCGACCTCGGCGTGCTGCAGGAC
GGTGAGCTGTACGTGCACGGCCGGCTCAAGGAGACGTTCACCGTGCACGGTCGCCACCTC
TACCCGCACGACGTCGAGCAGGAACTGCGCGCACGGCACCCGGAACTCGGCAAGTGCGGC
GCGGTCTTCCCGGGACGGGCTCCCGGCGCCGGCGGCGCGCGGGGCGTGGTCGTGACCCAT
GAGGTGACCAACGCGGCGCGGGATCGGCTGCCGGAGCTGGCCGCCGGGTTACGGCATACC
GTGGGGCGGGCATTCGGCGTCGAGGTCTCCGCGGTGCTGCTGCTACGTCCGGGTGCCGTG
CTGCGTACCACCAGCGGGAAGATCCGCCGCTCGGCCATGCGTGAGCTGTTCCACGAGGGA
AAGCTGACCGCTCTCTACCAGCATCCTCCGGCGCCGCGGGAGCCGCTGCCCTACGTGGGG
GATCCGTCGCCGGCGACCAGGGTGACCAGCCTTTCGCGTCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [41-477]  2.09999999999996e-82 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [169-180]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit