close all open/close all

CDS information : Teicp_00290


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction60,326 / 61,381 / + [in whole cluster]
60,326 / 61,381 / + [in contig]
Location60326..61381 [in whole cluster]
60326..61381 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative phospho-2-dehydro-3-deoxyheptonate aldolase
putative 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
putative DAHP synthase
Product (GenBank)heptulosonate synthase
Gene
Gene (GenBank)
EC number2.5.1.54
Keyword
  • Bht
  • Hpg
  • Dpg
  • Tyr
Note
Note (GenBank)
  • ORF14*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AY1
NITE
Teicp2_00360
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q9WYH8
PmId
[12743122] Thermotoga maritima 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase: the ancestral eubacterial DAHP synthase? (J Biol Chem. , 2003)

close this sectionSequence

selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [heptulosonate synthase]
MVVVMAPEATSADVDAVVRLVESVGGQAFVSRGLSRTIVGLVGDVADFEALNLGSLAGVL
RVIRVSVPYKLVSREHHPARSVIRAGGVPIGPGTLTVIAGPCAVEVPGQTLEAARMARSA
GASMLRGGAFKPRTSPYSYQGLGERGLRILADVRAETGLAVVTEVIDPGSVDMVASYADM
LQIGARNMQNFALLQAVGSAGKPVLLKRGFSATIEEWLSAAEYIAQRGNLNIVLCERGIR
TFETATRNTLDISAVPVAQRLSHLPVIVDPSHSGGRRDLVVPLTRAAIAVGADGLLIDVH
PEPKTALCDGDQALPEADIREIADIVASLPAFLGREPAVPSGEFRHVPAAV
selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [heptulosonate synthase]
ATGGTCGTTGTGATGGCGCCGGAGGCCACTTCGGCGGATGTGGACGCGGTCGTCCGGCTG
GTCGAGTCGGTGGGCGGGCAGGCGTTCGTCAGCCGCGGGCTGTCCCGGACCATCGTCGGC
CTGGTCGGCGACGTGGCCGACTTCGAGGCGCTCAACCTGGGCAGCCTGGCGGGCGTGCTG
CGGGTGATCCGGGTGTCGGTGCCGTACAAGCTGGTCAGCCGGGAGCACCACCCGGCGCGC
TCGGTGATCCGGGCCGGCGGCGTGCCGATCGGTCCCGGCACGCTGACCGTGATCGCCGGG
CCGTGCGCGGTGGAGGTCCCCGGACAGACGCTGGAGGCGGCCCGGATGGCGCGCTCGGCC
GGGGCCTCGATGCTGCGCGGCGGGGCGTTCAAGCCGCGGACCTCACCGTACTCCTACCAG
GGGTTGGGGGAGCGGGGCCTGCGCATCCTGGCCGACGTGCGGGCCGAGACGGGGCTCGCC
GTGGTCACCGAGGTGATCGATCCCGGCAGTGTGGACATGGTCGCGTCGTACGCCGACATG
CTCCAGATCGGCGCCCGGAACATGCAGAATTTCGCGCTGCTGCAGGCGGTCGGGTCGGCC
GGCAAACCGGTGCTGCTCAAGCGCGGGTTCAGCGCCACGATCGAGGAATGGCTCAGCGCC
GCCGAGTACATCGCGCAGCGCGGCAATCTGAACATCGTGTTGTGTGAGCGCGGGATCCGG
ACGTTCGAGACCGCTACCCGTAACACGCTGGACATCAGCGCGGTGCCGGTCGCCCAGCGG
CTCTCCCACCTGCCGGTGATCGTGGATCCGTCGCACTCCGGCGGCCGCCGCGATCTGGTG
GTGCCGCTGACCCGCGCGGCGATCGCGGTGGGCGCGGACGGGTTGCTCATCGACGTCCAC
CCGGAGCCGAAGACCGCTCTGTGCGACGGTGACCAGGCGCTGCCGGAAGCCGACATCCGG
GAGATCGCCGACATCGTGGCGAGCCTGCCCGCGTTCCTGGGGCGGGAGCCGGCCGTGCCC
TCGGGTGAATTCCGACACGTTCCCGCCGCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006218 DAHP synthetase I/KDSA (Domain)
 [88-326]  6.70000000000005e-75 PF00793
PF00793   DAHP_synth_1
IPR006268 Phospho-2-dehydro-3-deoxyheptonate aldolase, subtype 2 (Domain)
 [71-324]  3.39999999999996e-115 TIGR01361
TIGR01361   DAHP_synth_Bsub
IPR013785 Aldolase-type TIM barrel (Domain)
 [94-336]  1.39999999999997e-95 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit