close all open/close all

CDS information : Teicp_00300


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction62,148 / 63,137 / + [in whole cluster]
62,148 / 63,137 / + [in contig]
Location62148..63137 [in whole cluster]
62148..63137 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional activator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF15*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZH8
NITE
Teicp2_00370
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[22806031] Manipulating the regulatory genes for teicoplanin production in Actinoplanes teichomyceticus. (World J Microbiol Biotechnol. , 2012)
[24161919] Evaluation of heterologous promoters for genetic analysis of Actinoplanes teichomyceticus--Producer of teicoplanin, drug of last defense. (J Biotechnol. , 2013)
[25104028] The pathway-specific regulatory genes, tei15* and tei16*, are the master switches of teicoplanin production in Actinoplanes teichomyceticus. (Appl Microbiol Biotechnol. , 2014)
ACC
Q7WZ87
NITE
A4092_00100
PmId
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
ACC
Q799B3
NITE
Balhi_00040
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional activator [transcriptional regulator]
MTPDEEALNRQPIMEMEISSLSLGGSPRLAGGDPVHLEAMVAAQGELPPIVVHRPTMRVI
DGSHRIQAALRRGETTIAGRFFDGSDDEAFVMSVWLNVSHGLPLALADRKRAAERIAVSH
PQWSDRRVAAVTGISPSTVADIRRRVAGTSAPEASRIGQDGRVRPLDCSAGRLLAGRLMA
ENPALSLRQVAKAAAISPETARDVRNRLLSGAELVPNRRPRDAAPVGVKGGRDRRPLNLI
RSGDRPEPVPDHAVVINRLMSDPALRYTDTGRNLLRLLSLHTRWAKEWEAIVDNLPPHCA
DAVADLARQFADLWADFASRVGPEERMAS
selected fasta
>putative transcriptional activator [transcriptional regulator]
TTGACACCTGACGAAGAGGCCCTCAACCGGCAGCCCATCATGGAGATGGAGATCAGTTCA
CTCAGCCTCGGCGGATCGCCCCGGCTCGCCGGGGGCGATCCGGTGCACCTGGAGGCCATG
GTCGCGGCGCAGGGGGAACTGCCGCCGATCGTGGTGCACCGCCCGACCATGCGGGTCATC
GACGGCTCGCACCGGATCCAGGCGGCCCTCCGGCGTGGGGAGACGACGATCGCCGGTCGT
TTCTTCGACGGCTCCGACGACGAGGCGTTCGTGATGTCGGTGTGGCTCAACGTCTCGCAC
GGCCTGCCGCTGGCCCTGGCCGACCGCAAACGCGCGGCCGAACGCATCGCCGTCTCGCAT
CCGCAGTGGTCGGACCGCCGCGTCGCCGCGGTGACCGGTATCTCGCCGAGCACGGTGGCC
GACATCCGCCGGCGGGTGGCCGGCACCTCGGCGCCCGAGGCCAGCCGGATCGGTCAGGAC
GGCCGGGTCCGCCCGCTGGACTGCAGCGCGGGCCGGCTGCTTGCCGGGCGGCTGATGGCC
GAGAATCCCGCCCTGTCGCTGCGGCAGGTGGCCAAAGCCGCGGCGATCTCTCCGGAGACG
GCCCGCGACGTCCGCAATCGGCTGCTCAGCGGCGCTGAGCTGGTGCCCAACCGGCGCCCG
CGAGACGCCGCGCCGGTGGGGGTGAAGGGCGGCCGGGACCGGCGCCCGCTGAACCTGATC
CGCTCCGGAGACCGGCCGGAACCCGTCCCCGACCACGCCGTCGTCATCAACCGGCTGATG
AGCGACCCGGCGCTTCGGTACACCGATACCGGCCGTAACCTGCTCCGCCTTCTGAGCCTG
CACACCCGCTGGGCGAAGGAGTGGGAGGCCATCGTCGACAACCTGCCGCCGCACTGCGCC
GACGCGGTGGCCGACCTGGCTCGCCAGTTCGCGGACCTGTGGGCCGACTTCGCCAGCCGG
GTCGGCCCGGAGGAGCGGATGGCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [13-100]  1.49999977583352e-10 SSF110849
SSF110849   ParBc
 [37-97]  2e-10 PF02195
PF02195   ParBc
SignalP No significant hit
TMHMM No significant hit