close all open/close all

CDS information : Teicp_00310


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction63,801 / 66,257 / + [in whole cluster]
63,801 / 66,257 / + [in contig]
Location63801..66257 [in whole cluster]
63801..66257 [in contig]
TypeCDS
Length2,457 bp (818 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional activator
Product (GenBank)LuxR regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AX9
NITE
Teicp2_00380
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[22806031] Manipulating the regulatory genes for teicoplanin production in Actinoplanes teichomyceticus. (World J Microbiol Biotechnol. , 2012)
[25104028] The pathway-specific regulatory genes, tei15* and tei16*, are the master switches of teicoplanin production in Actinoplanes teichomyceticus. (Appl Microbiol Biotechnol. , 2014)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional activator [LuxR regulatory protein]
MTLRKHQLELLLFDEVHRASARGEGAVLLVSGAVGTGKTALLQAMAARAGRRGGWSFVVT
GSARERGHPFGVLDRLIRSMCAAGMAEPFPGGMDCGENFFVMMDRVGAAIREFAGDRPVL
VGIDDVHFVDEQSLRAVSYLIRRIESSGVVLVLNESTSYERDMAGLRAEMLHLPFCYRIR
LTPLTSTEVAERLSERFGGVPDRASVQFGVQVSGGIPLILQALIDDLADSGPGVCEPGAN
FRQAVLRSLHRCAPSTTAVAQAIAVLGDYAAPELVAELGGVDAALIEESIRDLREMGLLE
HDWFRHPHTRAAVLAGIPVPQLPEMHRRAAELLHQSGAPAGAVAEHLIAAQDGGRAPWRV
VILSEAAREALAAGDVDSAVLSLRHAVAASSDETQRAHAGVLLAEAQWHTDPSRAARRLG
ELSQDARAGRFTGPDTLIAVNQLLWWGEFAEADELLRLAGDEECGDSSLAHLWAIFSRAA
GGTEICDEHTPSGGSPLARSGPMAVVTYLSSAASLASESVAADRTEMLLGIRAGAPLTPA
LYALVVLVQSGRLEEAITWCGRLLKEEWIHRTPMRRVMIQTIESVAMLRAGDSAGALRGI
REVFDAVPPPAWGVVAGLPLSVAVRASTELGDTHAARSYLAVPVPPAMFDTPFALPYLLA
LGWYHLAMGHPESSLRHTRSCLDLTARWGVDAGRITAGPAGLDVSRPSPPPAADRVDAGH
RTPAAVREPAPDQREATPVPPHAGPDPAEPAAAHRGAEDGARLTDAEQRVAALAAAGNTN
RQIAERLFITVSTVEQHLTKIYRKLNLRSRSGLRRYSH
selected fasta
>putative LuxR family transcriptional activator [LuxR regulatory protein]
GTGACACTGCGTAAACATCAGTTGGAATTGCTCCTGTTCGACGAGGTTCACCGGGCATCA
GCGCGTGGCGAAGGTGCGGTGCTGCTCGTCAGCGGCGCGGTGGGCACCGGGAAGACCGCG
CTGCTGCAGGCGATGGCCGCGCGTGCCGGCCGCCGGGGCGGCTGGTCGTTCGTGGTCACC
GGTTCGGCCCGCGAGCGCGGGCACCCGTTCGGCGTGCTGGACCGCCTGATCCGGTCGATG
TGCGCGGCCGGGATGGCCGAGCCGTTCCCGGGCGGCATGGACTGCGGCGAGAACTTCTTC
GTGATGATGGACCGGGTGGGCGCCGCGATCCGGGAGTTCGCCGGCGACCGGCCGGTGCTC
GTCGGTATCGACGACGTTCACTTCGTCGACGAGCAGTCGCTGCGGGCCGTCAGCTACCTC
ATCCGGCGGATCGAGTCGAGCGGTGTGGTGCTGGTGCTCAACGAGAGCACCTCGTACGAG
CGTGACATGGCCGGTCTGCGCGCCGAGATGCTGCACCTGCCGTTCTGCTACCGGATCCGG
CTCACCCCGCTGACCTCCACCGAGGTCGCCGAGCGGCTGAGCGAGCGGTTCGGCGGCGTG
CCCGACCGGGCGTCCGTGCAATTCGGCGTGCAGGTCAGCGGGGGGATCCCGCTCATCCTG
CAGGCCCTGATCGACGATCTCGCCGACTCCGGCCCGGGCGTGTGCGAGCCGGGCGCCAAC
TTCCGCCAGGCCGTGTTGCGCAGCCTGCACCGGTGCGCGCCGTCGACCACCGCGGTGGCC
CAGGCCATCGCGGTCCTCGGCGACTACGCGGCGCCGGAGCTGGTCGCCGAGCTCGGCGGT
GTGGACGCCGCCCTGATCGAGGAGAGCATCCGCGACCTGCGGGAGATGGGCCTGCTGGAG
CACGACTGGTTCCGGCACCCGCACACCCGGGCCGCGGTGCTGGCCGGCATCCCGGTGCCG
CAGCTGCCCGAGATGCACCGGCGCGCCGCGGAGCTGCTGCATCAGAGCGGGGCGCCGGCC
GGCGCCGTGGCGGAGCACCTGATCGCCGCGCAGGACGGCGGCCGGGCGCCGTGGCGGGTG
GTCATCCTGTCGGAGGCGGCCCGCGAGGCGCTGGCCGCCGGCGACGTGGACAGCGCGGTG
CTGAGCCTGCGACATGCCGTCGCGGCCAGCTCCGACGAGACGCAGCGGGCGCACGCGGGC
GTGCTGCTCGCCGAGGCGCAGTGGCACACCGACCCCAGCCGGGCGGCGCGCCGCCTGGGC
GAGCTGAGCCAGGACGCGCGGGCCGGCCGGTTCACCGGCCCCGACACCCTGATCGCGGTC
AACCAGCTGCTCTGGTGGGGCGAGTTCGCCGAGGCCGACGAGCTGCTGCGGCTGGCCGGG
GACGAGGAGTGCGGCGACTCCAGCCTCGCTCACCTGTGGGCGATCTTCAGCCGGGCCGCC
GGGGGGACGGAGATCTGCGACGAGCACACCCCGTCCGGCGGCTCGCCGCTGGCGCGATCC
GGTCCGATGGCCGTGGTCACCTACCTGAGCTCGGCGGCGAGCCTGGCCTCCGAGAGCGTG
GCGGCCGATCGCACCGAGATGCTGCTCGGCATCCGGGCCGGCGCCCCGCTCACTCCCGCC
CTGTACGCCCTGGTCGTCCTGGTGCAGTCCGGCCGGCTGGAGGAGGCGATCACCTGGTGC
GGTCGCCTGCTGAAGGAGGAGTGGATCCACCGGACGCCGATGCGGCGGGTGATGATCCAG
ACGATCGAGTCGGTGGCCATGCTCCGGGCCGGCGACAGCGCGGGCGCCCTGCGGGGCATC
CGGGAGGTGTTCGACGCCGTTCCGCCACCGGCGTGGGGCGTGGTGGCGGGCCTGCCGCTG
TCGGTCGCGGTGCGGGCCAGCACCGAACTGGGCGACACCCATGCCGCCCGGTCGTACCTG
GCGGTCCCGGTGCCACCGGCGATGTTCGACACGCCGTTCGCGCTGCCGTACCTGCTGGCG
CTCGGCTGGTACCACCTGGCCATGGGCCACCCGGAGAGCTCGCTGAGGCACACCCGGTCG
TGTCTGGACCTGACCGCGCGCTGGGGCGTCGACGCGGGGCGGATCACCGCCGGGCCGGCC
GGGCTGGACGTGTCCCGGCCGTCGCCGCCACCGGCCGCGGACCGGGTGGACGCGGGCCAC
CGGACCCCGGCCGCGGTCCGGGAACCGGCGCCGGATCAGCGGGAGGCCACGCCGGTGCCG
CCGCACGCCGGCCCGGACCCGGCGGAGCCCGCGGCGGCGCACCGCGGAGCCGAGGACGGC
GCCAGGCTCACCGACGCGGAACAGCGGGTGGCCGCGCTGGCCGCCGCCGGCAACACCAAC
CGGCAGATCGCCGAGCGCCTGTTCATCACCGTGAGCACCGTCGAGCAGCATCTCACGAAA
ATCTATCGGAAGCTGAATCTGCGCAGCCGTTCCGGGTTGCGGCGATACAGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [760-817]  2.70000183580794e-22 SM00421
SM00421   HTH_LUXR
 [761-815]  2.1e-13 PF00196
PF00196   GerE
 [763-777]  6.59999852526376e-09 PR00038 [777-793]  6.59999852526376e-09 PR00038 [793-805]  6.59999852526376e-09 PR00038
PR00038   HTHLUXR
 [756-818]  PS50043
PS50043   HTH_LUXR_2
IPR003593 AAA+ ATPase domain (Domain)
 [24-185]  6.99999965558827e-06 SM00382
SM00382   AAA
IPR011990 Tetratricopeptide-like helical (Domain)
 [546-704]  4.70000000000001e-09 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [758-816]  4.5e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [741-818]  4.19999771339581e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit