close all open/close all

CDS information : Teicp_00320


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction66,438 / 67,559 / + [in whole cluster]
66,438 / 67,559 / + [in contig]
Location66438..67559 [in whole cluster]
66438..67559 [in contig]
TypeCDS
Length1,122 bp (373 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)DpgA protein
GenedpgA
Gene (GenBank)
EC number
Keyword
  • type III PKS
  • Dpg
Note
Note (GenBank)
  • ORF17*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZH6
NITE
Teicp2_00390
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q939X3
NITE
Balhi_00320
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
ACC
O52795
NITE
Chlor_00280
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[12240210] Biosynthesis of the vancomycin group of antibiotics: characterisation of a type III polyketide synthase in the pathway to (S)-3,5-dihydroxyphenylglycine. (Chem Commun (Camb). , 2001)
[14744141] Role of the active site cysteine of DpgA, a bacterial type III polyketide synthase. (Biochemistry. , 2004)
[22492619] Chain elongation and cyclization in type III PKS DpgA. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

B1
CHS98..371

close this sectionSequence

selected fasta
>polyketide synthase [DpgA protein]
MGVDVPMTATLERASASPVGIPPAISRMVGVGTAVAGTTVSQPALLDLLGIEDPKIRSIY
LNSAIGTRRLTLPEPDASGVRRPEPQGALLAKHKRLAVEMGGQALQACLKNIGASLSDLR
HLCCVTSTGFLTPGLSALMIKELGIDPHCSRSDIVGMGCNAGLNALNVVAGWSAAHPGEL
GVVLCTEACSAAYALDGTMRTAVVNSLFGDGAAALALISDAPGQSRPGPRILKFASFLIT
DAIDAMRYDWDSDLGRFSFFLDPQIPYVVGANAETVVDRLLAGTGLRRRDIAQWLVHSGG
KKVIDAVVVNLGLTRHDVRHTTRILRDYGNVSSGSFLFSYERLVEEGVTRPGDYGVLMTM
GPGSTIETALVQW
selected fasta
>polyketide synthase [DpgA protein]
GTGGGGGTGGATGTACCGATGACGGCCACCCTCGAACGCGCTTCCGCCTCGCCCGTCGGC
ATCCCGCCGGCCATCTCCCGGATGGTCGGGGTGGGCACCGCCGTCGCCGGGACGACGGTC
TCCCAGCCGGCATTGCTGGATCTTCTCGGCATCGAGGACCCGAAGATCCGCTCGATCTAC
CTGAACAGCGCCATCGGCACCCGCCGCCTCACCCTGCCGGAGCCCGACGCGTCCGGCGTG
CGCCGCCCCGAGCCGCAGGGCGCGCTGCTGGCCAAGCACAAGCGCCTCGCCGTCGAGATG
GGCGGGCAGGCGCTGCAGGCCTGCCTCAAGAACATCGGCGCCTCCCTCTCCGACCTGCGG
CACCTGTGCTGCGTGACGTCGACCGGCTTCCTCACCCCGGGCCTGAGCGCCCTGATGATC
AAGGAACTCGGCATCGACCCGCACTGCAGCCGCTCCGACATCGTGGGGATGGGCTGCAAC
GCCGGCCTCAACGCGCTCAACGTCGTCGCCGGCTGGTCCGCCGCCCACCCCGGCGAGCTC
GGCGTGGTCCTGTGCACCGAGGCGTGCTCGGCCGCGTACGCCCTGGACGGCACCATGCGC
ACCGCGGTGGTCAACAGCCTCTTCGGCGACGGCGCCGCCGCCCTGGCGCTGATCAGTGAC
GCTCCCGGGCAGTCGAGGCCCGGACCGCGGATCCTCAAGTTCGCCAGCTTCCTGATCACC
GACGCGATCGACGCCATGCGCTACGACTGGGACAGCGACCTGGGCCGGTTCAGCTTCTTC
CTGGACCCGCAGATCCCGTACGTCGTCGGCGCCAACGCGGAGACCGTGGTGGACCGCCTG
CTCGCCGGCACCGGCCTGCGCCGCCGTGACATCGCGCAGTGGCTGGTGCACTCCGGCGGC
AAGAAGGTGATCGACGCGGTCGTGGTCAATCTCGGACTGACCCGCCACGACGTCCGGCAC
ACCACCCGGATCCTGCGCGACTACGGCAACGTCTCCAGCGGCTCGTTCCTCTTCTCCTAC
GAGCGGCTGGTCGAGGAGGGCGTCACCCGCCCCGGAGACTACGGAGTGCTGATGACCATG
GGCCCCGGCTCGACCATCGAAACGGCGCTGGTCCAGTGGTGA
[1] CHS98..371
[1] CHS292..1113

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001099 Chalcone/stilbene synthase, N-terminal (Domain)
 [98-220]  1.5e-14 PF00195
PF00195   Chal_sti_synt_N
IPR011141 Polyketide synthase, type III (Family)
 [1-373]  2.50000909916183e-125 PIRSF000451
PIRSF000451   PKS_III
IPR012328 Chalcone/stilbene synthase, C-terminal (Domain)
 [258-371]  2.6e-16 PF02797
PF02797   Chal_sti_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [27-222]  4.80000000000003e-39 G3DSA:3.40.47.10 [230-373]  1.09999999999999e-33 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [30-373]  1.79999754022375e-43 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit