close all open/close all

CDS information : Teicp_00330


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction67,556 / 68,221 / + [in whole cluster]
67,556 / 68,221 / + [in contig]
Location67556..68221 [in whole cluster]
67556..68221 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)DpgB protein
GenedpgB
Gene (GenBank)
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
  • ORF18*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZH5
NITE
Teicp2_00400
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
O52796
NITE
Chlor_00290
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [DpgB protein]
MTAAGVDDLVLRIDGSEPVTPATVEAVLGICDRAEDGYAAGLLTVHVSGVPAPGWTSDLS
VGLTTKWERAVRRLERLGLLTAGVATGDCGGAALDLLLATDVRIAVAGARLVVPVSGDAT
WPGMALYRLARQGATAGLRRAALLGTPLDAARAVAAGVIDVVVDRPEPALAEIAAAAAGI
TGTELAIRRQLMLDAAEHSFEEAVGSHLAACDRTLRRAAAS
selected fasta
>putative enoyl-CoA hydratase [DpgB protein]
GTGACCGCGGCCGGCGTCGACGACCTGGTGCTGCGGATCGACGGGAGCGAGCCGGTCACG
CCGGCCACCGTCGAGGCGGTGCTGGGCATCTGTGATCGGGCCGAGGACGGGTACGCCGCC
GGGCTGCTGACCGTCCACGTCTCGGGCGTCCCGGCTCCCGGCTGGACGAGCGACCTCAGC
GTCGGCCTGACGACCAAGTGGGAGCGCGCCGTCCGCCGGCTGGAGCGCCTCGGCCTGCTC
ACCGCCGGGGTGGCCACCGGCGACTGCGGCGGCGCGGCGCTGGACCTGCTGCTGGCCACC
GACGTGCGGATCGCCGTCGCCGGCGCCCGGCTGGTCGTCCCGGTGAGCGGCGACGCGACC
TGGCCGGGCATGGCGCTGTACCGGCTCGCCCGGCAGGGCGCCACCGCCGGGCTGCGCCGG
GCCGCCCTGCTCGGCACCCCGCTCGACGCCGCTCGGGCGGTGGCGGCCGGGGTGATCGAC
GTGGTGGTGGACCGGCCCGAGCCGGCGCTCGCCGAGATCGCCGCCGCGGCGGCCGGCATC
ACCGGCACCGAGCTGGCCATCCGGCGGCAGCTGATGCTCGACGCCGCGGAGCACAGCTTC
GAGGAGGCGGTCGGCTCGCACCTGGCCGCGTGCGACCGGACCCTGCGCCGGGCGGCGGCG
TCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [66-203]  1.8e-05 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit