close all open/close all

CDS information : Teicp_00350


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction69,548 / 70,354 / + [in whole cluster]
69,548 / 70,354 / + [in contig]
Location69548..70354 [in whole cluster]
69548..70354 [in contig]
TypeCDS
Length807 bp (268 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)DpgD protein
GenedpgD
Gene (GenBank)
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
  • ORF20*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZH3
NITE
Teicp2_00420
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
O52797
NITE
Chlor_00310
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [DpgD protein]
MSSVTAARVRYHRTGHVARVTLDRPDVLNAMDLRMHEELARIWDDIEADDRIRVVVLTGA
GDRAFSVGQDLKERARRDAAGTPGSSFGSRGQPGWPRLTERFGFSKPVVARVDGYALGGG
FELALACDLIIASDRSVFGLPEVRLGLVPGAGGVFRLVRQLPQKTAMGYLLTGRRFDAAT
ALRFGLVNEVVPAQRLDACVDGWVDDLVTSAPLSVRAIKEAALRSVDLPLPDAFTATYRW
EQRRRASADAVEGPRAFAERRAPRWSGT
selected fasta
>putative enoyl-CoA hydratase [DpgD protein]
GTGTCCAGCGTGACCGCGGCCCGGGTGCGGTACCACAGGACCGGCCACGTCGCCCGGGTC
ACGCTCGACCGTCCCGACGTGCTCAACGCCATGGATCTGCGGATGCACGAGGAACTGGCG
CGGATCTGGGACGACATCGAGGCCGACGACCGGATCCGGGTCGTGGTGCTGACCGGCGCC
GGGGACCGCGCGTTCTCGGTGGGCCAGGACCTCAAGGAGCGTGCCCGCCGCGACGCGGCG
GGCACCCCGGGGTCCAGTTTCGGCAGCCGCGGCCAGCCCGGCTGGCCGCGGCTCACCGAG
CGGTTCGGGTTCAGCAAGCCGGTGGTCGCGCGCGTCGACGGGTACGCCCTCGGCGGCGGC
TTCGAGCTCGCGCTGGCCTGCGATCTGATCATCGCATCGGACCGCTCGGTGTTCGGGCTG
CCGGAGGTGCGGCTCGGGCTCGTGCCGGGGGCCGGCGGCGTGTTCCGGCTGGTCCGGCAG
CTGCCGCAGAAGACGGCGATGGGCTACCTGCTGACCGGCCGTCGCTTCGACGCGGCGACC
GCGCTCCGGTTCGGGCTGGTCAACGAGGTGGTGCCGGCGCAGCGGTTGGACGCTTGCGTG
GACGGCTGGGTCGATGATCTCGTCACAAGCGCGCCACTGTCGGTCCGGGCGATCAAGGAA
GCCGCGCTGCGCTCGGTCGACCTGCCGCTGCCGGACGCCTTCACCGCCACGTACCGCTGG
GAGCAGCGGCGCCGCGCCAGCGCGGACGCCGTCGAGGGGCCCCGGGCGTTCGCCGAGCGC
CGGGCGCCGCGCTGGTCCGGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [11-259]  6.6999999999999e-58 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [109-129]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit