close all open/close all

CDS information : Teicp_00360


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction70,393 / 71,754 / + [in whole cluster]
70,393 / 71,754 / + [in contig]
Location70393..71754 [in whole cluster]
70393..71754 [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)Na+-H+ antiporter
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF21*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZH2
NITE
Teicp2_00430
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q939X8
NITE
Balhi_00270
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [Na+-H+ antiporter]
MSFEAPPSSLGGHALLAFLIAVATLLLVAHLLARLAERVRMPAVVGELATGVILGPSLLG
HLLPGLTDWVFPPGTDQMHLLDAVGQIGILLLVGLTGTHLDVAMVRRRKATAARISLGGL
LLPLALGVGVGYQLAGWLSGAVVGDRLVFAGFMGVAMCVTAIPVIAKTLSDMRLLHRDVG
QMTLAAGTIDDAVGWFLLSVVSMAATAGLTTGHVVQAVAYLLGFVVLAVLLGRPLVRRVM
RLADRGEGSGSSIVTAVVVVLTGAAITQALGMEPVFGAFVAGILVGLPAAANQAKLAALR
TVVLSVLAPLFLATAGFRMDLTALADPQVAIAAVLVLAIAIVGKFAGAYAGARLSRLSRW
EGLAIGAGMNSRGVVEVVVALTGLRLGVLNTATYTIVVLVAIVTSVMAPPLLRYACARIA
QNEDERLRKLHHDTWNGVPAGAGQSPSPAGEQA
selected fasta
>putative transporter [Na+-H+ antiporter]
ATGTCCTTCGAAGCGCCGCCGTCGTCACTGGGCGGCCATGCCCTGCTCGCTTTCCTGATC
GCGGTGGCGACGCTGCTGCTGGTCGCCCACCTGCTGGCCCGCCTGGCGGAACGGGTGCGG
ATGCCGGCCGTCGTGGGTGAGCTGGCCACCGGCGTCATCCTGGGCCCGTCCCTGCTGGGC
CACCTGCTGCCCGGACTGACCGACTGGGTCTTCCCGCCCGGCACCGACCAGATGCACCTG
CTCGACGCGGTAGGTCAGATCGGCATCCTGCTCCTGGTCGGACTCACCGGCACCCACCTG
GACGTCGCCATGGTGCGGCGGCGCAAGGCCACCGCCGCGCGGATCAGCCTGGGCGGCCTG
CTGCTGCCGCTGGCTCTCGGGGTCGGCGTCGGCTACCAGCTGGCCGGCTGGCTCAGCGGC
GCCGTGGTCGGTGACCGGCTGGTCTTCGCCGGATTCATGGGCGTCGCGATGTGCGTGACA
GCCATCCCGGTGATCGCCAAAACCCTCTCCGACATGCGGCTGCTGCACCGCGACGTGGGC
CAGATGACGCTGGCGGCGGGCACCATCGACGACGCGGTCGGCTGGTTCCTGCTGTCCGTG
GTGTCGATGGCCGCGACCGCCGGGCTCACCACCGGACACGTCGTCCAGGCGGTCGCCTAC
CTGCTCGGCTTCGTCGTCCTCGCGGTTCTGCTCGGCCGGCCGCTGGTCCGCCGCGTCATG
CGGCTGGCCGACCGCGGCGAGGGATCCGGCTCCAGCATCGTCACCGCGGTCGTCGTCGTC
CTGACCGGCGCGGCGATCACCCAGGCGCTGGGCATGGAGCCGGTCTTCGGCGCCTTCGTG
GCGGGCATCCTGGTCGGGCTGCCCGCGGCGGCGAACCAGGCGAAGCTGGCGGCGCTGCGC
ACGGTCGTGCTCAGCGTGCTGGCGCCGCTCTTCCTCGCCACGGCCGGCTTCCGGATGGAC
CTGACCGCGCTGGCCGACCCGCAGGTCGCGATCGCCGCGGTGCTCGTGCTGGCCATCGCC
ATCGTCGGCAAGTTCGCCGGGGCGTACGCCGGGGCCCGCCTCAGCCGGCTGTCCCGCTGG
GAGGGCCTGGCGATCGGCGCCGGGATGAACTCGCGCGGCGTGGTCGAGGTGGTGGTGGCG
CTCACCGGCCTGCGACTGGGCGTGCTGAACACCGCCACCTACACGATCGTCGTCCTGGTC
GCCATCGTCACCTCGGTGATGGCCCCGCCGCTGCTGCGCTACGCCTGTGCCCGCATCGCC
CAGAACGAGGACGAGCGGCTGCGCAAGCTGCACCACGACACCTGGAACGGCGTCCCGGCC
GGCGCCGGCCAGTCCCCCTCACCCGCAGGAGAGCAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [24-412]  1.29999999999998e-52 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [10-32]  Transmembrane (o-i) [44-66]  Transmembrane (i-o) [81-103]  Transmembrane (o-i) [115-137]  Transmembrane (i-o) [147-169]  Transmembrane (o-i) [182-204]  Transmembrane (i-o) [214-236]  Transmembrane (o-i) [248-270]  Transmembrane (i-o) [274-291]  Transmembrane (o-i) [296-318]  Transmembrane (i-o) [328-350]  Transmembrane (o-i) [386-408]  Transmembrane (i-o)
Transmembrane 12