close all open/close all

CDS information : Teicp_00380


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction72,485 / 73,831 / + [in whole cluster]
72,485 / 73,831 / + [in contig]
Location72485..73831 [in whole cluster]
72485..73831 [in contig]
TypeCDS
Length1,347 bp (448 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative aminotransferase
Product (GenBank)HpgT protein
GenehpgT
Gene (GenBank)
EC number2.6.1.-
Keyword
  • Hpg
  • Dpg
Note
Note (GenBank)
  • ORF23*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AX2
NITE
Teicp2_00450
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
O52815
NITE
Chlor_00180
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
ACC
Q939Y4
NITE
Balhi_00210
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative aminotransferase [HpgT protein]
MESSALRKSELHPSISDPVLDTMNFLNEVTLRYPEAISFAPGRPYDGFFQTEEVLAHLRR
FLDHLADQGASPAQVRTAVYQYGPTAGQIREIIADSLRRDEGIDVPAESIVVTVGAQEAM
MLVVRALIRDPRDVLLVPSPCYVGITGVARLLDVTLGPVPESPDGFSLENVAAAIRAQRA
AGRRPRAFYLVPDHANPSGTTLSESDRAGLLHLAAKEDLLILEDTPYRLVSPGEPVRTLK
ALDRRRSVVHLGSYSKTIFPGARVGFAVADQTVVGDDGRTGLLADELSKIKSMVTVNTSS
LSQAVVAGALLAAGGRVSELNAKAAGHYGDAMRRVLDRLADRLPAARRAELGVRWNEPSG
GFFLSLTVGFEADDAALTRSAEQFGVIWTPMRYFHPDGGGRRAIRLSVSYLSPEEIDEGI
TRLVAFIEAETRRHRARPGTLPAGHGAV
selected fasta
>putative aminotransferase [HpgT protein]
GTGGAATCGTCTGCGCTGCGCAAGTCGGAATTGCATCCGAGCATTTCGGACCCGGTTCTG
GACACGATGAATTTCCTCAACGAGGTGACCCTGCGCTATCCCGAGGCGATCTCGTTCGCG
CCGGGCCGCCCGTACGACGGCTTCTTCCAGACCGAGGAGGTCCTCGCCCACCTGCGCCGC
TTTCTCGACCACCTGGCCGACCAGGGCGCCTCGCCCGCGCAGGTGCGCACGGCGGTCTAC
CAGTACGGCCCGACCGCCGGCCAGATCCGCGAGATCATCGCCGACTCGCTGCGCCGGGAC
GAGGGGATCGACGTGCCGGCCGAGTCCATCGTGGTCACCGTCGGCGCGCAGGAGGCGATG
ATGCTGGTCGTCCGCGCGCTGATCCGTGACCCGCGGGACGTGCTGCTGGTGCCCAGCCCC
TGCTACGTGGGCATCACCGGGGTGGCCCGGCTGCTCGACGTGACGCTCGGCCCGGTGCCC
GAGTCGCCGGACGGCTTCTCCCTGGAGAACGTGGCGGCGGCGATCCGGGCGCAGCGGGCC
GCCGGGCGCCGGCCGCGAGCCTTCTACCTGGTGCCCGACCACGCCAACCCGTCCGGCACC
ACGCTGTCCGAGTCGGACCGGGCCGGGTTGCTGCACCTGGCCGCGAAGGAGGATCTGCTG
ATCCTGGAGGACACCCCGTACCGGCTGGTCAGCCCCGGCGAGCCGGTGCGCACGCTGAAG
GCGCTGGACCGCCGCCGCTCGGTGGTGCACCTGGGGTCGTACTCAAAAACGATCTTTCCG
GGCGCGCGGGTGGGCTTCGCCGTGGCCGACCAGACGGTGGTCGGCGACGACGGCCGGACC
GGCCTGCTCGCCGACGAGCTCTCGAAGATCAAGAGCATGGTGACGGTCAACACCTCGTCG
CTGAGCCAGGCGGTGGTGGCCGGCGCGCTGCTCGCGGCCGGCGGCCGGGTCTCCGAGCTG
AACGCCAAGGCGGCCGGGCACTACGGCGACGCCATGCGCCGGGTGCTCGACCGGCTCGCC
GACCGGTTGCCCGCGGCGCGGCGCGCGGAGCTGGGCGTGCGGTGGAACGAACCCAGCGGC
GGCTTCTTCCTGAGCCTGACCGTCGGGTTCGAGGCCGACGACGCGGCGCTCACCCGGTCC
GCCGAGCAGTTCGGCGTCATCTGGACCCCCATGCGGTACTTCCACCCGGACGGCGGTGGC
CGCCGGGCGATCCGGCTGTCGGTCAGCTATCTGTCGCCGGAGGAGATCGACGAGGGGATC
ACCCGGCTGGTCGCGTTCATCGAGGCCGAGACCCGCCGGCACCGGGCCCGTCCCGGCACC
CTCCCGGCGGGGCACGGCGCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [80-423]  2.5e-24 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [76-299]  2.19999999999997e-47 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [300-428]  6.80000000000001e-09 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-428]  2.39999798157263e-75 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit