close all open/close all

CDS information : Teicp_00390


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction73,867 / 74,985 / + [in whole cluster]
73,867 / 74,985 / + [in contig]
Location73867..74985 [in whole cluster]
73867..74985 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)prephenate dehydrogenase
Genepdh
Gene (GenBank)
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
  • ORF24*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q799B2
NITE
Balhi_00050
PmId
[20570618] Increased glycopeptide production after overexpression of shikimate pathway genes being part of the balhimycin biosynthetic gene cluster. (Metab Eng. , 2010)
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
ACC
P20692
PmId
[4321765] The enzymology of prephenate dehydrogenase in Bacillus subtilis. (J Biol Chem. , 1970)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [prephenate dehydrogenase]
MRTLLVIGTGLIGTSVALAARRAGVAVFLADRDVAAARVAEALGAGLAEPPRRPVDLALV
AVPPAQVGPVLRDAQANRAAHSYTDVAGVKGQPERDVLRLASDPASYVGGHPMAGRERSG
PLAATADLFAGKTWVLTPNERTGAAALERATTLAEICGAAPVRLDSRAHDTVVALTSHVP
HLMASLTAARLLHGPAATEALVGQGVRDVTRIAAGDPALWTDIVRSNAPAVAAVLRGVRD
DLTRLLAATDILAGHHPGGRAQAEHTVTDLLERGVAGAARTRPPAGAPEGFAVLRVVLDG
RPGSLARLLEAVAAHGGSARRAGAAPGPDAALAVDVELPAAGADAAAAALAAAGWAVSRP
GLASAARRGPHR
selected fasta
>putative prephenate dehydrogenase [prephenate dehydrogenase]
GTGCGCACTCTTCTCGTGATCGGAACCGGACTGATCGGTACGTCGGTGGCGCTGGCCGCG
CGTCGCGCCGGGGTGGCGGTGTTCCTCGCCGACCGCGACGTCGCCGCGGCCCGGGTCGCC
GAGGCGCTCGGCGCGGGCCTGGCCGAGCCGCCCCGCCGGCCGGTGGATCTCGCGCTCGTC
GCGGTGCCGCCCGCCCAGGTCGGCCCGGTGCTGCGGGACGCGCAGGCCAATCGCGCGGCG
CACAGCTACACCGACGTGGCCGGGGTCAAGGGGCAGCCGGAACGCGACGTCCTGCGGCTG
GCCAGCGACCCGGCGTCGTACGTCGGCGGGCACCCGATGGCCGGGCGGGAACGTTCCGGC
CCGCTGGCCGCCACGGCCGACCTGTTCGCCGGCAAGACCTGGGTGCTCACCCCGAACGAG
CGCACCGGCGCCGCGGCGCTGGAGCGCGCCACCACGCTCGCCGAGATCTGCGGTGCGGCG
CCGGTGCGGCTGGACAGCCGGGCGCACGACACCGTGGTGGCGCTGACCTCGCACGTCCCG
CATCTGATGGCCAGCCTCACCGCGGCCCGCCTGCTGCACGGGCCGGCCGCCACCGAGGCG
CTGGTGGGCCAGGGGGTCCGTGACGTCACCCGGATCGCGGCCGGCGACCCGGCGCTGTGG
ACCGACATCGTCCGGTCGAACGCGCCGGCGGTCGCCGCCGTGCTGCGCGGCGTCCGCGAC
GACCTCACCCGGCTCCTCGCCGCCACCGACATCCTGGCCGGCCACCACCCGGGCGGGCGG
GCCCAGGCCGAGCACACCGTCACCGACCTGCTGGAGCGAGGCGTCGCCGGGGCGGCCCGG
ACCCGGCCGCCCGCCGGGGCGCCGGAGGGCTTCGCCGTGCTCCGGGTGGTCCTCGACGGC
CGCCCCGGCAGCCTGGCCCGCCTGCTGGAGGCGGTCGCGGCGCACGGCGGCAGCGCGCGC
CGGGCCGGCGCGGCGCCCGGACCGGATGCCGCCCTGGCCGTCGATGTGGAGCTACCGGCG
GCCGGGGCCGACGCGGCGGCGGCCGCGCTCGCCGCGGCCGGCTGGGCGGTCAGCCGCCCC
GGCCTCGCCTCCGCGGCGCGCCGAGGGCCGCACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003099 Prephenate dehydrogenase (Domain)
 [2-282]  PS51176
PS51176   PDH_ADH
 [16-245]  1.5e-56 PF02153
PF02153   PDH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [165-248]  2.60000517657733e-21 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [2-170]  3.39999999999999e-25 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-19]  0.627 Signal
Eukaryota   
 [1-19]  0.498 Signal
Bacteria, Gram-positive   
TMHMM No significant hit