close all open/close all

CDS information : Teicp_00400


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction76,780 / 75,242 / - [in whole cluster]
76,780 / 75,242 / - [in contig]
Locationcomplement(75242..76780) [in whole cluster]
complement(75242..76780) [in contig]
TypeCDS
Length1,539 bp (512 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)nonheme iron dioxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF25*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q7WZ63
NITE
A4092_00340
PmId
[16499611] A derivative of the glycopeptide A40926 produced by inactivation of the beta-hydroxylase gene in Nonomuraea sp. ATCC39727. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [nonheme iron dioxygenase]
MGVNEPVRLRSNAIIEPLVDRFYAWLHTVAPVPAALHLADFQVPLLESYLRDPRARAAAG
AGPAPTGGHLAELDETGGMEIAALLDGIKRDRADMLGLAAAVTEAEDLLQRYGRTPPHPG
LPAALHGLVQPVSGPGRQPAIRVLESLAYDSRYYDERRQSVRLSLDDGAERPGILGTPRL
PRPGALDLAVPFRHAGLDELFAARLRPTTLSRLREALELDDTRAGRLRALLTTEPGTAPE
RHLDAGGRIRFFGHACLLFQTPEAAVITDPFISADNRHGDRYTFDDLPDHIDLAVITQGR
PDHVVLETLLQLRSRIGAMVVPRSSRGNLHDPSIGRCLRALGFPVIEVDDFDEVPFPGGR
VVAAPFLDEHGEPDVRAKSTYLVQLAGASVFVGADSSGVDPVAYRLMRRQLGRVDLAFLG
MRRDNAPPARPAGQTRGRSGCDARQAAAIMQELGADEGYVYVMGEQPWQRHVMAAAGHRD
PGRRTQIDEFLGWCRERGITAERLLHRREWRW
selected fasta
>putative oxidoreductase [nonheme iron dioxygenase]
ATGGGCGTCAACGAGCCGGTCCGGCTCCGCTCCAACGCGATCATCGAGCCACTGGTCGAC
CGGTTCTACGCCTGGTTGCACACCGTGGCCCCGGTCCCGGCGGCCCTGCACCTCGCCGAT
TTCCAGGTCCCGCTGCTGGAGTCGTACCTGCGCGATCCGCGGGCGCGCGCGGCGGCCGGG
GCCGGCCCGGCGCCGACCGGCGGACACCTCGCCGAGCTCGACGAGACAGGCGGCATGGAG
ATCGCCGCGCTGCTGGACGGCATCAAGCGCGACCGGGCCGACATGCTCGGGCTCGCGGCC
GCCGTGACCGAGGCCGAGGACCTGCTGCAGCGGTACGGCCGCACGCCGCCGCACCCGGGG
CTGCCCGCCGCGCTGCACGGCCTGGTCCAGCCGGTGTCCGGCCCGGGCCGGCAGCCGGCG
ATCCGCGTCCTCGAATCGCTGGCATACGACAGCCGGTACTACGACGAGCGCCGGCAGTCG
GTACGGCTGTCGCTCGACGACGGCGCCGAGCGGCCCGGCATCCTCGGCACGCCACGGCTG
CCCCGGCCCGGGGCGCTCGACCTGGCGGTCCCGTTCCGGCACGCCGGCCTGGACGAACTC
TTCGCGGCCCGGCTGCGGCCCACCACGTTGTCGCGGCTGCGCGAGGCGCTGGAGCTCGAC
GACACCCGGGCCGGCCGGCTGCGGGCGCTGCTGACCACCGAGCCCGGCACCGCACCGGAG
CGGCACCTCGACGCGGGTGGCCGGATCCGCTTCTTCGGGCACGCCTGCCTGCTGTTCCAG
ACGCCGGAGGCCGCGGTGATCACCGATCCGTTCATCAGCGCCGACAACCGGCACGGTGAC
CGGTACACCTTCGACGACCTGCCGGACCACATCGACCTGGCGGTCATCACGCAAGGCCGC
CCGGACCACGTGGTGCTGGAGACGCTGCTGCAACTACGCTCCCGGATCGGCGCGATGGTG
GTTCCCCGGTCCTCGCGCGGCAACCTGCACGATCCGTCGATCGGCCGGTGTCTCAGGGCG
CTGGGCTTCCCGGTGATCGAGGTGGACGACTTCGACGAGGTGCCGTTCCCCGGTGGCCGG
GTGGTCGCCGCGCCGTTCCTGGACGAGCACGGCGAGCCGGACGTCCGCGCCAAGTCGACG
TACCTGGTGCAGCTGGCCGGGGCGAGCGTCTTCGTCGGCGCCGACTCCTCGGGCGTCGAT
CCGGTGGCGTACCGCTTGATGCGCCGGCAGCTCGGCCGGGTGGACCTCGCGTTCCTCGGT
ATGCGACGGGACAACGCGCCACCGGCCCGGCCGGCGGGCCAGACGCGCGGGCGTTCCGGC
TGCGACGCACGGCAGGCCGCCGCGATCATGCAGGAGCTCGGCGCGGACGAGGGCTACGTC
TACGTCATGGGGGAACAGCCCTGGCAGCGTCACGTCATGGCGGCCGCCGGCCACCGGGAC
CCGGGCCGCCGGACGCAGATCGACGAGTTCCTCGGCTGGTGCCGGGAGCGCGGCATCACC
GCCGAGCGCCTGCTGCACCGACGCGAGTGGCGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019204 Domain of unknown function DUF2070, membrane (Domain)
 [309-475]  8.49999999999995e-29 PF09843
PF09843   DUF2070
SignalP No significant hit
TMHMM No significant hit