close all open/close all

CDS information : Teicp_00410


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction77,142 / 76,855 / - [in whole cluster]
77,142 / 76,855 / - [in contig]
Locationcomplement(76855..77142) [in whole cluster]
complement(76855..77142) [in contig]
TypeCDS
Length288 bp (95 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative chorismate mutase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number5.4.99.5
Keyword
  • Bht
  • Hpg
  • Dpg
  • Tyr
Note
Note (GenBank)
  • ORF26*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
P9WIC1
PmId
[15737998] Purified recombinant hypothetical protein coded by open reading frame Rv1885c of Mycobacterium tuberculosis exhibits a monofunctional AroQ class of periplasmic chorismate mutase activity. (J Biol Chem. , 2005)
[18727669] A comparative biochemical and structural analysis of the intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis H(37)R(v) and the secreted chorismate mutase (y2828) from Yersinia pestis. (FEBS J. , 2008)
[19556970] Structure and function of a complex between chorismate mutase and DAHP synthase: efficiency boost for the junior partner. (EMBO J. , 2009)

close this sectionSequence

selected fasta
>putative chorismate mutase [hypothetical protein]
MAPEETITEPRQTPPAESIARMRARIDEIDAAIIALWRERAELSRQVGAVRLAEGGTRLV
LSRETEILRRFRAGIGGSDGTQLGLLVLRAGRGRL
selected fasta
>putative chorismate mutase [hypothetical protein]
ATGGCCCCGGAAGAGACGATCACCGAACCCCGGCAGACGCCTCCTGCCGAGTCCATCGCG
CGGATGCGCGCCCGCATCGACGAGATCGACGCGGCGATCATCGCGCTGTGGCGCGAGCGC
GCCGAGCTGTCCCGCCAGGTCGGCGCGGTCCGCCTCGCCGAGGGCGGGACACGCCTGGTC
CTGTCCCGGGAGACCGAGATCCTGCGACGGTTCCGGGCCGGCATCGGCGGCAGCGACGGA
ACGCAGCTGGGCCTGCTCGTGCTGCGCGCCGGGCGGGGCCGGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002701 Chorismate mutase (Domain)
 [13-95]  PS51168
PS51168   CHORISMATE_MUT_2
 [11-71]  5.90000000000001e-13 G3DSA:1.20.59.10
G3DSA:1.20.59.10   Chorismate_mutase
 [23-85]  2.00000075217457e-09 SM00830
SM00830   CM_2
IPR010958 Chorismate mutase, high GC Gram-positive bacteria/archaeal (Domain)
 [19-93]  3.3e-17 TIGR01808
TIGR01808   CM_M_hiGC-arch
IPR020822 Chorismate mutase, type II (Domain)
 [23-72]  9.10000000000001e-08 PF01817
PF01817   CM_2
 [17-73]  9.10000425645573e-11 SSF48600
SSF48600   Chorismate_mut
SignalP No significant hit
TMHMM No significant hit