close all open/close all

CDS information : Teicp_00420


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction77,365 / 78,192 / + [in whole cluster]
77,365 / 78,192 / + [in contig]
Location77365..78192 [in whole cluster]
77365..78192 [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative siderophore-interacting protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF27*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
A5F660
PmId
[8083157] Identification, cloning, and sequencing of a gene required for ferric vibriobactin utilization by Vibrio cholerae. (J Bacteriol. , 1994)
Family/Domain
FD
IPR013113, IPR007037

close this sectionSequence

selected fasta
>putative siderophore-interacting protein [hypothetical protein]
MSGHVLAAHRPIVALSARRLTRIAPRMTRLVADGPGVRRFVPDGCTDAFVRVVFPRPGVR
YPPGLDPRRIRAELPRADWPRTRTYTVRRLDPVAAELTIDFVDHGPAGLAPPWLAALRPG
DPVLVQDAGGRYRPDPRAGWHLLAGDETALPAIAVTLAALAPRARAVALVEVDTAADELP
LCSAADVDLRWVHRCRGGDLVEAVRDLRFAPGAVQAFVHGEGGAVQHLRRHLLRDRAVAP
RLLSASGYWRRGLDDEQWRARKAAMASPVPAAGGR
selected fasta
>putative siderophore-interacting protein [hypothetical protein]
ATGTCCGGACACGTATTGGCCGCGCACCGTCCGATCGTCGCATTGTCGGCCCGGCGGCTC
ACCAGGATCGCGCCGAGAATGACCAGGCTGGTCGCGGATGGGCCGGGGGTCCGCCGATTC
GTGCCGGACGGCTGCACCGACGCCTTCGTCCGCGTCGTCTTCCCCCGGCCCGGCGTGCGC
TACCCGCCCGGCCTGGACCCGCGCCGGATCCGCGCCGAGCTGCCCCGCGCGGACTGGCCC
CGCACCCGCACCTACACCGTGCGGCGCCTCGACCCGGTGGCCGCCGAACTGACCATCGAC
TTCGTCGACCACGGCCCGGCCGGGCTCGCCCCGCCGTGGCTGGCCGCGCTGCGGCCCGGC
GACCCGGTCCTGGTCCAGGACGCCGGCGGCCGGTACCGGCCGGACCCGCGGGCCGGCTGG
CACCTGCTGGCCGGCGACGAGACGGCGCTGCCGGCCATCGCCGTGACGCTGGCCGCCCTG
GCGCCGCGGGCCCGGGCGGTGGCCCTGGTGGAGGTGGACACCGCCGCCGACGAGCTGCCG
CTGTGCAGCGCCGCCGATGTCGACCTGCGCTGGGTGCACCGGTGCCGGGGCGGCGATCTG
GTCGAGGCGGTGCGCGATCTGCGGTTCGCGCCCGGCGCGGTCCAGGCGTTCGTGCACGGC
GAGGGCGGGGCCGTCCAGCACCTGCGCCGCCACCTGCTGCGGGACCGCGCGGTGGCGCCG
CGGCTGCTGTCGGCCTCCGGGTACTGGCGCCGCGGGTTGGACGACGAGCAGTGGCGCGCG
CGCAAGGCCGCGATGGCGTCGCCGGTCCCCGCCGCGGGCGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007037 Siderophore-interacting protein (Domain)
 [138-252]  4.9e-33 PF04954
PF04954   SIP
IPR013113 FAD-binding 9, siderophore-interacting (Domain)
 [18-131]  9.20000000000002e-31 PF08021
PF08021   FAD_binding_9
IPR017927 Ferredoxin reductase-type FAD-binding domain (Domain)
 [7-135]  PS51384
PS51384   FAD_FR
IPR017938 Riboflavin synthase-like beta-barrel (Domain)
 [18-138]  8.89999852234942e-07 SSF63380
SSF63380   Riboflavin_synthase_like_b-brl
SignalP No significant hit
TMHMM No significant hit