close all open/close all

CDS information : Teicp_00430


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction78,467 / 79,528 / + [in whole cluster]
78,467 / 79,528 / + [in contig]
Location78467..79528 [in whole cluster]
78467..79528 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)HmaS protein
GenehmaS
Gene (GenBank)
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
  • ORF28*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AX1
NITE
Teicp2_00460
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [HmaS protein]
MTMTGHFQDLTVDHVRIYCADLDPLIAQFGSYGLDVRAEGVGPGAEHSVVLGHGDIRLVL
TRPGTGDHPGGMYTAQHGYGVSDIALGTADAAGAFHEAVRRGARPIAAPERTAGVVTASV
AGFGDVIHTFVQREPGGPWSLPGLNPVHRPGTPGIGLRLVDHFAVCVEAGRLTEVVEHYE
RVFGFSAIFTERIVVGEQAMDSQVVQSAGGAVTLTVIAPDTTRRPGQIDTFLKDHGGPGV
QHIAFETDDVTRSVGAMSDAGIEFLTTPAAYYERLRDRLQLTRHSVTELSRLNVLADEDH
DGQLYQIFTKSTHPRGTLFFEIIERVGARTFGSGNIKALYEAVELDQAAADGR
selected fasta
>putative 4-hydroxymandelate synthase [HmaS protein]
GTGACGATGACCGGCCACTTCCAGGACCTGACCGTCGACCACGTACGGATCTACTGCGCG
GACCTCGACCCGTTGATCGCCCAATTCGGCAGCTACGGCCTCGACGTGCGGGCCGAGGGC
GTCGGGCCGGGCGCGGAGCACTCGGTCGTTCTCGGGCACGGCGACATCCGGCTGGTGCTG
ACCCGGCCCGGCACCGGCGACCACCCCGGCGGGATGTACACCGCGCAGCACGGCTACGGC
GTGTCCGACATCGCGCTCGGTACGGCCGACGCGGCCGGCGCCTTCCACGAGGCGGTCCGG
CGCGGGGCACGGCCGATCGCCGCCCCCGAGCGGACCGCCGGCGTGGTCACCGCCTCGGTC
GCCGGCTTCGGCGACGTCATCCACACCTTCGTCCAGCGCGAGCCGGGAGGACCGTGGTCG
CTGCCGGGGCTGAACCCGGTGCACCGGCCCGGCACGCCCGGCATCGGCCTGCGGCTGGTC
GACCACTTCGCGGTGTGCGTCGAGGCCGGCCGGCTCACCGAGGTCGTCGAGCACTACGAG
CGGGTGTTCGGCTTCTCGGCCATCTTCACCGAGCGGATCGTGGTCGGCGAGCAGGCGATG
GACTCCCAGGTCGTGCAGAGCGCCGGCGGGGCCGTGACGCTCACCGTGATCGCGCCGGAC
ACCACCCGCCGGCCGGGGCAGATCGACACCTTCCTCAAGGACCACGGCGGCCCGGGGGTC
CAGCACATCGCGTTCGAGACCGACGACGTGACCCGCTCGGTCGGCGCCATGAGCGACGCC
GGCATCGAGTTCCTCACCACACCGGCCGCCTACTACGAGAGGCTGCGGGACCGGCTGCAG
CTCACCCGGCACTCGGTCACCGAGCTGAGCCGGCTCAACGTGCTCGCCGACGAGGACCAC
GACGGCCAGCTCTACCAGATCTTCACCAAGTCCACGCACCCGCGGGGAACGCTGTTCTTC
GAGATCATCGAGCGGGTCGGGGCCCGGACCTTCGGCTCCGGCAACATCAAGGCCCTGTAC
GAGGCCGTGGAGCTGGACCAGGCCGCGGCAGACGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [1-353]  PIRSF009283
PIRSF009283   HPP_dOase
 [12-349]  6.49999999999992e-100 TIGR01263
TIGR01263   4HPPD
SignalP No significant hit
TMHMM No significant hit