close all open/close all

CDS information : Teicp_00450


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction80,755 / 81,507 / + [in whole cluster]
80,755 / 81,507 / + [in contig]
Location80755..81507 [in whole cluster]
80755..81507 [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase, type II
Gene
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • ORF30*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
[27285718] Characterization of the Post-Assembly Line Tailoring Processes in Teicoplanin Biosynthesis. (ACS Chem Biol. , 2016)
Related Reference
ACC
Q6ZZG3
NITE
Teicp2_00480
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)
ACC
Q9LAS9
PmId
[12055297] Type II thioesterase from Streptomyces coelicolor A3(2). (Microbiology. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase, type II]
MPVPWFSAPRPLAAPRLRLVCFPYAGGNAATYRSWAGLLPPGVELVAALLPGRAERLDEP
PLVDLDVLLSELVAAAGPLLGPVPLILFGHSLGATVAYEFGRALATEHGCVPAALLVSGA
PAPPVRRRRTGRGLSDDDLERILGKRTDLPAGWLTAELKPFVFPALRADLQLLDGYRWRP
GPLPGVPVVAFGGDADPDVSAADLRAWQRCTTGPARTHVLAGDHFFIAHQPFRELLAATV
GEFAASPIAR
selected fasta
>putative type II thioesterase [thioesterase, type II]
ATGCCCGTACCTTGGTTCAGCGCGCCGCGCCCGCTCGCGGCCCCACGGTTGCGGCTGGTC
TGTTTCCCGTACGCCGGGGGCAACGCCGCCACCTACCGCTCCTGGGCCGGACTCCTGCCG
CCCGGGGTGGAGCTGGTCGCCGCGCTGCTGCCCGGCCGCGCCGAGCGCCTCGACGAGCCG
CCCCTGGTGGATCTGGACGTGCTGCTGTCCGAGCTGGTGGCGGCGGCCGGCCCGCTGCTC
GGCCCGGTCCCGCTGATCCTGTTCGGACACAGCCTCGGCGCGACCGTCGCGTACGAGTTC
GGCCGCGCCCTGGCCACCGAGCACGGTTGCGTGCCCGCGGCCCTGCTGGTCTCCGGCGCC
CCGGCGCCCCCGGTGCGCCGGCGCCGCACCGGCCGCGGCCTCTCCGACGACGACCTCGAA
CGGATCCTGGGCAAACGCACCGATCTCCCGGCCGGGTGGCTGACCGCCGAGCTCAAGCCG
TTCGTGTTCCCGGCCCTGCGGGCCGACCTGCAGCTGCTCGACGGCTACCGCTGGCGGCCC
GGCCCGCTTCCCGGCGTGCCGGTGGTCGCCTTCGGCGGGGATGCCGATCCGGACGTGTCC
GCCGCCGATCTGCGGGCGTGGCAGCGGTGCACGACCGGCCCGGCCCGCACCCACGTGCTG
GCCGGCGACCATTTCTTCATCGCGCACCAACCGTTCCGCGAGCTTCTCGCCGCCACGGTG
GGCGAGTTCGCCGCCAGCCCGATCGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [18-229]  7.00000000000005e-37 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit