close all open/close all

CDS information : Teicp_00460


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction82,083 / 83,699 / + [in whole cluster]
82,083 / 83,699 / + [in contig]
Location82083..83699 [in whole cluster]
82083..83699 [in contig]
TypeCDS
Length1,617 bp (538 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF31*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q70AW8
NITE
Teicp2_00490
Family/Domain
FD
IPR001387

close this sectionSequence

selected fasta
>putative transcriptional regulator [transcriptional regulator]
MFGEHVRTHRQRLGLTQDDLAERAGLGVRSIRNIEAGRVRVPRPSTVRLLADAFALTGPA
RDLFCSIAAAPRAVPVAPSDPPVVPRQLPAASPAHVGRRAALAALDQLLVTPCRLAVVQG
PAGIGKSTLALHWAHRVASRFPDGQLYLDLQGYGPAPAPLGVADALCRLLDGFGVPAARI
PADTDARAALLRSVTADRSFLLVLDNARDADQVRPLLPGAPGAVTVVTSRADHAGLVTTA
AARLVPLGLFHERDAIDLLTHHLGAERVAAEPAAVSAIIGRCARLPLALAIIAGRGAARA
DFPLSELTGGPSVLDELTGDDVGADFRTVISWSYRLLSTSAARLFRLLGAAPGRDIGPAA
AASLAGTPVRATRRDLRELTAAHLAHEHRSGRYQVHALLRSYAVELCSGHDPASERDTAR
RRLVDHYLHAAYAAAPLLAPRLARGPLPARCDGVTAERPADSRAAFDWFTDEYPNLVEVL
ALARDLGLHAHAWQLAGAVGAFRHRRGRWHDVIGPHRDAPAVAPGDPIASGTPGTGSA
selected fasta
>putative transcriptional regulator [transcriptional regulator]
GTGTTCGGTGAGCATGTGCGGACCCACCGGCAGCGACTCGGTCTCACCCAGGACGACCTG
GCCGAGCGGGCCGGGCTGGGAGTGCGCAGCATTCGCAACATCGAGGCGGGCCGGGTTCGT
GTGCCCCGGCCGTCCACGGTACGGCTGCTCGCCGACGCCTTCGCGCTGACCGGCCCTGCC
CGGGACCTGTTCTGCTCGATCGCCGCTGCGCCCCGGGCCGTGCCGGTGGCCCCGAGCGAC
CCGCCGGTCGTGCCGCGGCAGCTGCCCGCCGCCAGCCCGGCGCATGTCGGGCGCCGAGCC
GCGCTGGCCGCCCTCGACCAGCTGCTGGTCACCCCGTGTCGGCTCGCGGTCGTGCAGGGC
CCCGCCGGGATCGGGAAGAGCACGCTGGCGCTGCACTGGGCGCACCGCGTCGCGTCCCGG
TTCCCCGACGGCCAGCTCTATCTGGACCTGCAGGGCTACGGCCCGGCCCCGGCCCCGCTC
GGCGTGGCGGATGCGCTGTGCCGCCTGCTGGACGGGTTCGGTGTGCCGGCGGCGCGCATC
CCCGCCGACACCGACGCCCGCGCCGCACTGTTGCGCAGCGTGACGGCCGACCGGAGCTTC
CTGCTCGTGCTCGACAACGCGCGCGACGCCGACCAGGTCCGGCCGCTGTTGCCGGGCGCG
CCGGGCGCCGTCACCGTCGTCACCAGCCGGGCCGACCACGCCGGCCTGGTCACGACAGCG
GCCGCGCGCCTGGTGCCCCTCGGCCTGTTCCACGAGCGGGACGCCATCGACCTGCTCACC
CACCACCTCGGCGCGGAGCGGGTGGCGGCCGAGCCGGCGGCCGTCTCCGCCATCATCGGG
CGCTGCGCGCGGCTGCCGCTCGCCCTCGCGATCATCGCCGGCCGCGGCGCGGCCCGCGCC
GACTTTCCGCTCAGCGAGCTGACCGGCGGCCCCTCGGTGCTCGACGAGCTCACCGGCGAC
GACGTCGGCGCCGACTTCCGGACCGTCATCTCCTGGTCGTACCGGCTGCTCAGCACGTCC
GCCGCGCGGCTGTTCCGGCTGCTCGGCGCGGCTCCCGGCCGGGACATCGGCCCCGCCGCG
GCGGCCAGCCTGGCCGGCACACCAGTGCGGGCGACCCGCCGCGACCTGCGCGAGCTCACC
GCCGCGCATCTGGCGCACGAGCACCGGTCCGGGCGGTACCAGGTGCACGCGCTGCTCCGG
TCCTACGCCGTCGAGCTGTGCTCCGGTCACGACCCGGCGTCCGAGCGGGACACCGCCCGG
CGCCGGCTCGTCGACCACTACCTGCATGCGGCGTACGCCGCCGCGCCGCTGCTCGCGCCA
CGGCTGGCGCGGGGGCCGCTGCCGGCCCGGTGCGACGGCGTCACCGCCGAGCGGCCCGCC
GACAGCCGAGCGGCGTTCGACTGGTTCACCGACGAGTACCCGAATCTGGTCGAGGTCCTG
GCCCTGGCCCGCGACCTGGGCCTGCACGCCCATGCCTGGCAGCTGGCCGGCGCGGTGGGC
GCGTTCCGGCACCGCCGCGGCCGATGGCACGACGTGATCGGACCGCACCGGGACGCGCCG
GCCGTGGCCCCCGGCGACCCCATCGCCAGCGGCACTCCGGGCACGGGCTCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [115-130]  1.10000029896148e-05 PR00364 [194-208]  1.10000029896148e-05 PR00364 [282-296]  1.10000029896148e-05 PR00364
PR00364   DISEASERSIST
IPR001387 Helix-turn-helix type 3 (Domain)
 [6-63]  PS50943
PS50943   HTH_CROC1
 [5-61]  1.69999922284049e-12 SM00530
SM00530   HTH_XRE
IPR002182 NB-ARC (Domain)
 [117-294]  4e-07 PF00931
PF00931   NB-ARC
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [2-56]  1.7e-13 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
 [1-54]  6.00000361638163e-11 SSF47413
SSF47413   Lambda_like_DNA
SignalP No significant hit
TMHMM No significant hit