close all open/close all

CDS information : Teicp_00470


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction85,345 / 84,452 / - [in whole cluster]
85,345 / 84,452 / - [in contig]
Locationcomplement(84452..85345) [in whole cluster]
complement(84452..85345) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • ORF32*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZG1
NITE
Teicp2_00510
Family/Domain
FD
IPR025161

close this sectionSequence

selected fasta
>putative transposase [transposase]
MPRVAAARRHDLTDVQWAVLEPALPAEPRRGRPPRWTKRQIIDGIRWRVRAGTPWRDVPE
VYAPWQTLYRWFRRWQRDGTWAKILARLQTRADAAGDIEWAVSVDSTISRAHQHAAGARR
DGDLQKEPPGGVFAEPGDHALGRSRGGFTTKTHLACEQGRKTLSTVITAGQRGDSPQFIK
VLERIKVYRVGGGRPRTRPDLVLADKAYTSRGNRGYARRRRIRVCIPSKADQDAYRKAKG
SKGGRPPAFDPVVYRQRHAVECGINQLKQNRAMATRYDKLAVRFEATVTIAVINQWL
selected fasta
>putative transposase [transposase]
GTGCCCAGGGTAGCGGCAGCGAGGCGACACGATCTCACCGACGTTCAGTGGGCGGTGCTG
GAACCTGCGCTGCCTGCGGAGCCACGGCGAGGCCGTCCGCCGCGATGGACGAAACGGCAG
ATCATCGATGGGATCCGGTGGCGGGTCCGGGCGGGAACACCGTGGCGGGACGTGCCCGAG
GTGTACGCACCCTGGCAGACGTTGTATCGCTGGTTCCGGCGCTGGCAGCGCGACGGGACG
TGGGCGAAGATCCTGGCCCGGCTCCAGACCCGGGCCGACGCCGCCGGTGACATCGAGTGG
GCGGTGAGCGTCGATTCCACGATCAGCCGTGCCCATCAGCATGCCGCGGGTGCCCGTCGT
GATGGTGACCTGCAGAAGGAACCGCCGGGTGGGGTGTTCGCCGAACCCGGCGATCATGCT
CTGGGCAGGTCCCGGGGCGGGTTCACCACCAAGACCCATCTGGCCTGTGAGCAGGGTCGT
AAGACGCTGTCGACGGTGATCACCGCTGGTCAGCGGGGTGACAGCCCGCAGTTCATCAAG
GTCCTGGAACGCATCAAGGTCTATCGGGTCGGTGGTGGCCGGCCCCGTACCCGGCCGGAT
CTGGTCCTGGCGGACAAGGCGTACACCAGCCGGGGCAATCGCGGGTACGCCCGCCGCCGC
AGGATCAGGGTGTGCATCCCGAGCAAGGCCGACCAGGACGCCTACCGCAAGGCCAAAGGC
TCCAAGGGCGGGCGTCCTCCGGCGTTCGACCCGGTCGTGTACCGGCAGCGTCACGCCGTG
GAATGCGGCATCAACCAGCTCAAACAGAACCGGGCGATGGCCACCCGGTACGACAAGCTT
GCCGTCCGCTTCGAAGCCACCGTCACCATCGCCGTCATCAACCAATGGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025161 Putative transposase IS4/IS5 family (Family)
 [12-85]  1.1e-26 PF13340
PF13340   DUF4096
SignalP No significant hit
TMHMM No significant hit