close all open/close all

CDS information : Teicp_00480


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction87,115 / 86,174 / - [in whole cluster]
87,115 / 86,174 / - [in contig]
Locationcomplement(86174..87115) [in whole cluster]
complement(86174..87115) [in contig]
TypeCDS
Length942 bp (313 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • ORF33*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Related Reference
ACC
Q6ZZG0
NITE
Teicp2_00520

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MITYRTTGLPGPAPTATVSVKPIVLPAARRGGDLQVRVSAPVTGTNLPVVVFAHGYGSNL
DGYGPLVDHWAAHGFVVVQATHLDSRRLDVAADRSRRPHLWLYRVRDMKRILDGLDVLEA
SVPGLTGRADHRRIVAAGHSFGGQTAGILVGLRVADPMTGIARDLSDSRVIASIQLATAG
RGGDDLTPFALQVAPWLRDQDFSHITAPGLVVAGDQDELPLSTRGASWMTDPYTLARGAR
SLLTVFGGQHSLGGISGYDAAETTDEHPDRVALIQQVTLAYLRHVTGVDHTGWRTAQALL
AGDSHRLGRLESK
selected fasta
>hypothetical protein [hypothetical protein]
ATGATCACGTATCGGACCACCGGTCTCCCCGGTCCCGCGCCCACGGCGACCGTATCGGTC
AAGCCGATCGTGCTGCCCGCGGCGCGGCGCGGCGGGGACCTGCAGGTGCGGGTCTCCGCA
CCGGTCACCGGCACCAACCTGCCGGTGGTGGTGTTCGCGCACGGATACGGATCGAACCTC
GACGGCTACGGACCGCTGGTCGATCACTGGGCGGCCCACGGCTTCGTGGTGGTCCAGGCC
ACCCACCTGGACTCCCGGCGCCTCGACGTCGCAGCGGACCGGTCCCGCAGGCCGCACCTC
TGGCTCTACCGGGTGCGGGACATGAAACGGATCCTCGACGGACTCGACGTTCTGGAGGCC
TCGGTGCCCGGGCTGACCGGCCGGGCCGACCATCGTCGTATCGTCGCGGCCGGGCACTCC
TTCGGCGGCCAGACCGCCGGCATCCTGGTGGGTCTGCGCGTCGCCGATCCGATGACCGGC
ATCGCGCGGGACCTGTCCGATTCCCGGGTCATCGCGAGCATTCAGCTGGCCACCGCCGGC
CGCGGCGGCGACGATCTGACCCCGTTCGCCCTCCAGGTCGCACCCTGGCTGCGCGACCAG
GACTTCTCGCACATCACCGCACCCGGGCTCGTCGTCGCCGGCGACCAGGACGAACTCCCG
CTGTCCACCCGCGGAGCGTCCTGGATGACCGACCCGTACACCCTGGCCCGCGGCGCCAGG
AGCCTGCTGACCGTTTTCGGCGGCCAGCACTCGCTCGGCGGCATCTCCGGTTACGACGCG
GCGGAGACCACCGACGAGCACCCGGACCGGGTCGCGCTCATCCAGCAGGTCACCCTCGCC
TACCTGCGCCACGTCACCGGCGTCGACCACACCGGCTGGCGAACCGCCCAGGCCCTCCTG
GCCGGTGACTCCCACCGGCTCGGCCGGCTCGAATCCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit