close all open/close all
Teicp_00480 Teicp_00480   last last

CDS information : Teicp_00490


close this sectionLocation

Organism
StrainDSM 43866 (=NBRC 13999)
Entry nameTeicoplanin
Contig
Start / Stop / Direction87,764 / 88,726 / + [in whole cluster]
87,764 / 88,726 / + [in contig]
Location87764..88726 [in whole cluster]
87764..88726 [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative metal ABC transporter substrate-binding protein
Product (GenBank)manganese ABC transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in teicoplanin biosynthesis.
Note (GenBank)
  • ORF34*
Reference
ACC
PmId
[15113000] Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase. (Chem Biol. , 2004)
Family/Domain
FD
IPR006127

close this sectionSequence

selected fasta
>putative metal ABC transporter substrate-binding protein [manganese ABC transporter]
MDRQRIFRAAATAAALTVIAGCGSGTPDEGGAAAGGAALAVVATTPEVADFVRNVGGADV
AVTQIIKPNVDPHDYEPTPADLQAIASAKVVVKSGVGLEEWLDRTIESAGFRGAVVDSSR
GVTLREGHEDEGAAGGHEGEDHDPHIWHDPRNAKIMVANIEAGLAAAEPGKAAAFQANLA
RYTAELDRLDADNEAAFARLPKDARKLVTNHDAFGYYVQRYGLEFVGSVIPSLDTSAELS
GKQLTDLVAKIKATGAKAVFAESSLPPKTAEALARQAGVEVVAGEDALFGDSLGEPGTPE
GTYLGAERHNTQVIVTALAG
selected fasta
>putative metal ABC transporter substrate-binding protein [manganese ABC transporter]
ATGGACAGGCAGCGCATCTTCCGGGCCGCGGCGACCGCGGCGGCCCTCACCGTGATCGCC
GGGTGTGGTTCCGGCACGCCGGACGAGGGCGGGGCGGCCGCCGGCGGCGCCGCCCTCGCC
GTCGTCGCCACGACGCCCGAGGTGGCGGACTTCGTCCGGAACGTCGGTGGCGCGGACGTC
GCGGTGACGCAGATCATCAAACCCAACGTCGATCCGCACGACTACGAGCCGACCCCCGCC
GACCTGCAGGCCATCGCCTCGGCGAAGGTGGTCGTCAAGAGCGGTGTCGGCCTGGAGGAG
TGGCTCGACCGCACCATCGAGTCGGCCGGCTTCCGCGGCGCGGTCGTCGACTCCAGCCGG
GGCGTGACGCTGCGCGAGGGGCACGAGGACGAGGGCGCGGCGGGGGGCCACGAGGGCGAG
GACCACGACCCGCACATCTGGCACGACCCGCGCAACGCCAAGATCATGGTGGCCAACATC
GAGGCGGGCCTGGCCGCCGCCGAGCCGGGGAAGGCGGCCGCGTTCCAGGCGAACCTGGCG
CGGTACACCGCGGAGCTGGACCGGCTCGACGCGGACAACGAGGCCGCCTTCGCCAGGCTG
CCGAAGGACGCCCGCAAGCTGGTCACCAACCACGACGCGTTCGGCTACTACGTGCAGCGT
TACGGACTGGAGTTCGTCGGCTCGGTGATCCCCAGCCTGGACACGTCGGCCGAGCTGTCC
GGCAAGCAGCTCACCGACCTGGTGGCGAAGATCAAGGCGACCGGCGCGAAGGCCGTCTTC
GCCGAGAGCTCGCTGCCGCCGAAGACCGCCGAGGCGCTCGCCCGGCAGGCCGGCGTCGAG
GTGGTCGCCGGCGAGGACGCGCTGTTCGGCGACAGCCTCGGCGAACCCGGCACGCCGGAG
GGTACCTACCTCGGCGCGGAACGGCACAACACGCAGGTCATCGTCACCGCGCTGGCCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006127 ABC transporter, metal-binding lipoprotein (Family)
 [41-318]  3.49999999999995e-75 PF01297
PF01297   SBP_bac_9
IPR006128 Adhesion lipoprotein (Family)
 [38-56]  1.20000117458134e-26 PR00690 [69-82]  1.20000117458134e-26 PR00690 [82-99]  1.20000117458134e-26 PR00690 [200-221]  1.20000117458134e-26 PR00690 [255-273]  1.20000117458134e-26 PR00690 [284-303]  1.20000117458134e-26 PR00690
PR00690   ADHESNFAMILY
IPR006129 Adhesin B (Family)
 [38-59]  4.40000933643892e-19 PR00691 [63-81]  4.40000933643892e-19 PR00691 [82-101]  4.40000933643892e-19 PR00691 [142-161]  4.40000933643892e-19 PR00691 [200-217]  4.40000933643892e-19 PR00691 [251-268]  4.40000933643892e-19 PR00691
PR00691   ADHESINB
SignalP
 [1-25]  0.5 Signal
Eukaryota   
TMHMM No significant hit
Teicp_00480 Teicp_00480   last last