close all open/close all
first first   Tetrn_00020 Tetrn_00020

CDS information : Tetrn_00010


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction901 / 2 / - [in whole cluster]
901 / 2 / - [in contig]
Locationcomplement(2..901) [in whole cluster]
complement(2..901) [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator(fragment)
Product (GenBank)putative transcriptional regulator, LuxR family
Gene
Gene (GenBank)tmn3
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator(fragment) [putative transcriptional regulator, LuxR family]
MATPSISAREAEVLALLGEHLSNAEIAGRLFISVRTVESHVSSLLRKLQLPDRRALARHA
AASARTTGQAGPPPALPAPLTAFVGRTRERAELAAAVRAHRQVTAVGPGGVGKTRLALAV
AGDLAGEFPDGVWFADLVPVADPVRVGAAVAAAVGVGEQPARDVDDAVLAALADHDALLV
LDNCEHVRDGVAPFLERLLAACPRLRVLATSRARLVVPFERAVPVPPLSRAGGDESDAVA
LFMDRAAAVGWPPGPGASAGVVAVCERLDGMALAIELAAARWATLGLDGLAAGLGDQLRI
selected fasta
>putative LuxR family transcriptional regulator(fragment) [putative transcriptional regulator, LuxR family]
GTGGCCACCCCGTCGATCTCCGCCCGCGAAGCCGAAGTGCTCGCGCTCCTCGGCGAGCAC
CTGAGCAACGCCGAGATCGCCGGGCGCCTCTTCATCTCCGTACGCACCGTCGAATCGCAC
GTCTCCTCGCTGCTGCGCAAGCTGCAACTGCCCGACCGGCGCGCCCTCGCCCGGCACGCC
GCCGCCTCGGCCCGCACCACCGGACAGGCAGGTCCCCCGCCCGCCCTGCCCGCGCCGCTG
ACGGCCTTCGTCGGCCGCACCCGCGAGCGCGCGGAGCTGGCCGCGGCGGTACGGGCCCAC
CGGCAGGTCACCGCCGTCGGCCCCGGCGGCGTGGGCAAGACGCGGCTCGCGCTCGCGGTG
GCCGGCGACCTGGCCGGCGAGTTCCCCGACGGCGTGTGGTTCGCCGACCTGGTCCCCGTC
GCCGACCCGGTGCGGGTGGGCGCCGCGGTCGCCGCCGCCGTGGGCGTCGGCGAGCAGCCC
GCGCGCGACGTGGACGACGCCGTGCTGGCCGCGCTCGCGGACCACGACGCGCTGCTTGTA
CTGGACAACTGCGAGCACGTACGTGACGGGGTCGCTCCGTTCCTGGAGCGGCTGCTCGCC
GCCTGCCCCCGGCTGCGCGTACTCGCCACCAGCCGGGCCCGCCTCGTGGTGCCCTTCGAG
CGCGCCGTCCCGGTGCCCCCGCTGTCGCGCGCCGGAGGCGACGAGTCCGACGCCGTGGCC
CTGTTCATGGACCGCGCCGCGGCCGTCGGCTGGCCGCCGGGACCCGGCGCGAGCGCGGGC
GTCGTCGCCGTCTGCGAACGACTCGACGGCATGGCCCTGGCCATCGAACTGGCCGCCGCC
CGCTGGGCCACCCTCGGGCTCGACGGCCTGGCCGCCGGCCTCGGCGACCAGCTGCGGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [6-20]  6.59999852526376e-09 PR00038 [20-36]  6.59999852526376e-09 PR00038 [36-48]  6.59999852526376e-09 PR00038
PR00038   HTHLUXR
 [1-64]  PS50043
PS50043   HTH_LUXR_2
 [4-60]  8.80000000000003e-15 PF00196
PF00196   GerE
 [3-60]  3.60000433965927e-21 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-61]  7.4e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [2-62]  2.89999717862184e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-24]  0.046 Signal
Bacteria, Gram-negative   
 [1-26]  0.084 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Tetrn_00020 Tetrn_00020