close all open/close all

CDS information : Tetrn_00020


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction1,056 / 1,523 / + [in whole cluster]
1,056 / 1,523 / + [in contig]
Location1056..1523 [in whole cluster]
1056..1523 [in contig]
TypeCDS
Length468 bp (155 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn4
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
  • Predicted flavin-nucleotide-binding site is conserved.
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Family/Domain
FD
IPR011576

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [hypothetical protein]
MTAPTHPAEPRTRARRRRDTEHRLAHDVDVWVASAAPDGTPYLVPLSFSWDGAAVWVATP
AGSPTGRNLAATGAARLALGPTRDVTLIDGGVEVFELDALPQEHGDRFAARAGFDPRGAA
GPYRWFRITPRRILAWREVNELKGRELMRDGRWLD
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [hypothetical protein]
ATGACCGCACCCACGCACCCCGCCGAGCCCCGGACCCGCGCGCGGCGCCGCCGGGACACC
GAGCACCGGCTCGCCCACGACGTGGACGTCTGGGTGGCCAGCGCGGCGCCGGACGGGACG
CCGTACCTCGTGCCGCTGTCGTTCTCCTGGGACGGCGCCGCGGTGTGGGTCGCGACGCCG
GCGGGGAGCCCGACCGGCCGGAACCTCGCCGCCACCGGTGCCGCGCGGCTGGCGCTCGGG
CCCACCCGGGACGTCACGTTGATCGACGGCGGGGTCGAGGTCTTCGAGCTGGACGCGCTG
CCGCAGGAGCACGGCGACCGCTTCGCGGCCCGCGCCGGCTTCGACCCGCGCGGCGCCGCC
GGCCCGTACCGCTGGTTCCGGATCACCCCGCGGCGGATCCTGGCCTGGCGCGAGGTGAAC
GAGCTGAAGGGGCGCGAGCTGATGCGCGACGGCCGCTGGCTGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [17-141]  1.20000117458134e-14 SSF50475
SSF50475   FMN_binding
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [30-83]  5.60000000000001e-07 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [12-152]  1.09999999999999e-43 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit