close all open/close all

CDS information : Tetrn_00030


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction2,518 / 5,250 / + [in whole cluster]
2,518 / 5,250 / + [in contig]
Location2518..5250 [in whole cluster]
2518..5250 [in contig]
TypeCDS
Length2,733 bp (910 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative transcriptional regulator, LuxR family
Gene
Gene (GenBank)tmn5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator, LuxR family]
MAFVIRAAEFEALRSAFSRCLHGMSRTILIEGGVGCGKSALLHAITEHAADMGATVLSVQ
GRSTAAHPPISLFQQLVAQVPAPPPGEGPAGATAALQFSAALPHVAENGAVVISVDDVQD
IPWSELDFLLQTVSWHRSRRTLILLSHCPHLRHRDQPVKTELLRRPNAQRIHLGPLDERG
VRAAVTTRVNRPHEQWIELLHHLSGGSPLLLRALLEDLRDEDMEVRPTGAETTSGPLGMY
GRAVVSCLYRSGASAVELGRLISVLGDSATPELLSGMTRISPAVMDQQLEALRDSGVLDG
TNFRHGSAPREILADLGTLQRNELHRRAAVVQNNAGSPTTEVARHLLAARHAAEAWQRSA
LRDAAETAIGQEKIRLAVRYLELALENSPNTPDRIEIYLRLALITQRISPAATEIRHLTA
LLSAFHSDKMPSTAYDGLADLLFSYGKIQEAFAVLRRQGAESSAADVRAGDHPSIAWLWA
WYSHHTDQPQNDGQAPRLPPPDGGGAGPYGATALFQTFEGSFLFGERGDWAAAAENLLEV
STLSDSTVWSMACAIKALVIADRLETAWQWCEWLVKESATRDAPGWQAVFSLQQATVALR
QGKLAAGLDCIRLVETVITERSSGYACAVETVLAATHMEMGRYDEVARVFAKPIPPAWEK
SIYWLSYLCARGSFHLATNRPHSALADFLRIGKVAERTLVDHPTLVPWRLYVAEAWLHLG
DEKMAARMLDEHTARDPGHGGRNHAMVLRLRARLAPPHRRVGLLFRAMDELLASGDRLEQ
ARTLHELGAALRGLGHDSWAARARAAAAHIARNCLPDQAVARSPAPERVGRPGPAAVSAV
GTPCPVGQKLLTRAEHRVAALVAKGLTNRQVAGRLHITVSTVEQHLTRIYQKLGIGQRAD
IGQRLKSLPA
selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator, LuxR family]
ATGGCTTTCGTCATCCGTGCGGCCGAATTCGAGGCGCTGCGGTCTGCTTTCTCTCGCTGT
CTCCACGGAATGTCGCGCACAATTCTCATCGAAGGCGGCGTGGGTTGCGGCAAGAGTGCG
CTATTACACGCCATCACTGAACACGCGGCAGACATGGGCGCGACCGTCCTCAGCGTCCAG
GGCAGGAGCACCGCGGCACACCCGCCCATCTCCCTGTTCCAGCAGCTCGTCGCGCAGGTG
CCGGCCCCGCCTCCCGGCGAGGGCCCGGCGGGGGCCACCGCCGCGCTCCAGTTCAGCGCC
GCGCTGCCGCACGTCGCGGAGAACGGCGCGGTGGTGATCAGCGTCGACGACGTCCAGGAC
ATTCCCTGGTCCGAACTCGACTTCCTGCTGCAGACCGTCAGTTGGCACCGCAGTCGGCGC
ACCCTCATCCTCCTCTCCCACTGCCCGCACCTGCGCCACCGCGACCAGCCGGTCAAGACC
GAGCTGCTGCGGCGGCCCAACGCGCAGCGCATCCACCTGGGTCCGCTGGACGAGCGAGGG
GTACGGGCGGCGGTCACCACGCGCGTCAACAGGCCGCACGAGCAGTGGATCGAGCTGCTG
CACCACCTCAGCGGCGGCAGCCCGCTGCTGCTGCGCGCGCTGCTGGAGGATCTGCGCGAC
GAGGACATGGAGGTCCGGCCGACGGGTGCGGAGACCACGTCGGGGCCGCTGGGCATGTAC
GGGCGCGCCGTCGTCTCCTGCCTTTACCGCAGCGGCGCCAGCGCCGTGGAACTGGGGCGG
CTCATCTCCGTGCTCGGGGATTCCGCGACGCCCGAGCTGTTGTCGGGCATGACCCGTATT
TCACCCGCGGTGATGGACCAGCAGTTGGAGGCGCTGCGCGACTCCGGGGTGCTGGACGGT
ACGAATTTCCGGCACGGGAGCGCTCCCCGGGAAATTCTTGCGGATCTCGGCACCCTCCAG
CGAAACGAACTGCACCGGCGCGCGGCCGTCGTCCAAAACAATGCGGGCAGTCCCACCACC
GAAGTGGCCCGCCATCTTCTCGCCGCCCGGCACGCGGCGGAGGCGTGGCAGCGCTCCGCG
CTGCGCGACGCCGCGGAGACGGCCATCGGCCAGGAGAAAATCCGGCTGGCCGTCAGGTAT
CTCGAACTGGCGCTGGAGAACAGCCCGAACACCCCGGACCGTATCGAGATATACCTGCGC
CTGGCGCTCATCACCCAGCGCATCAGCCCCGCGGCCACCGAGATCCGGCATCTGACCGCG
CTGCTCAGCGCGTTCCATTCGGACAAAATGCCCAGCACGGCGTACGACGGACTCGCCGAC
CTGCTCTTCAGCTACGGCAAGATCCAGGAGGCGTTCGCCGTACTGCGGCGCCAGGGCGCC
GAGTCGAGCGCCGCCGACGTCCGCGCCGGCGATCACCCCAGCATCGCGTGGCTGTGGGCC
TGGTACAGCCACCACACCGACCAGCCGCAGAACGACGGGCAGGCCCCGCGGCTCCCGCCG
CCCGACGGCGGCGGGGCGGGCCCGTACGGGGCGACCGCCCTGTTCCAGACCTTCGAGGGG
TCGTTCCTCTTCGGCGAGCGCGGCGACTGGGCCGCCGCCGCCGAGAACCTGCTGGAGGTC
TCGACCCTCTCCGACTCCACGGTCTGGTCGATGGCCTGCGCCATCAAAGCCCTCGTCATC
GCCGACCGGCTCGAAACCGCCTGGCAGTGGTGCGAGTGGCTGGTCAAGGAGTCGGCGACC
CGGGACGCACCGGGCTGGCAGGCCGTCTTCTCGCTGCAGCAGGCGACGGTCGCGCTGCGG
CAGGGCAAGCTGGCGGCGGGCCTTGACTGCATCCGGCTGGTGGAGACCGTCATCACCGAG
CGCAGCTCGGGGTACGCGTGCGCGGTCGAGACCGTACTCGCCGCCACGCACATGGAGATG
GGGCGCTACGACGAGGTGGCGCGGGTGTTCGCCAAGCCGATTCCCCCCGCGTGGGAGAAG
AGCATCTACTGGCTGAGCTACCTGTGCGCCCGCGGCTCCTTCCATCTCGCCACGAACAGG
CCGCACTCGGCGCTCGCCGACTTCCTGCGGATCGGGAAGGTGGCCGAGCGCACCCTCGTC
GACCACCCCACGCTCGTGCCGTGGCGGCTCTACGTCGCCGAGGCGTGGCTGCACCTGGGC
GACGAGAAGATGGCCGCGCGCATGCTCGACGAGCACACCGCGCGCGACCCGGGCCACGGC
GGCCGCAACCACGCGATGGTGCTGCGGCTGCGGGCCCGGCTCGCGCCGCCGCACAGGCGC
GTCGGCCTGCTGTTCCGCGCGATGGACGAGCTCCTCGCCTCCGGCGACCGGTTGGAGCAG
GCGCGTACGCTCCACGAACTCGGCGCGGCGCTGCGGGGGCTCGGCCACGACTCCTGGGCG
GCCAGGGCCCGGGCGGCGGCCGCGCACATCGCCCGCAACTGCCTGCCCGACCAGGCCGTG
GCGCGCTCGCCGGCGCCGGAGCGGGTGGGCAGGCCCGGGCCGGCGGCGGTGAGCGCGGTG
GGTACACCGTGTCCCGTCGGCCAGAAGCTGCTGACCCGGGCGGAGCACCGGGTCGCCGCG
CTGGTGGCGAAGGGGCTGACCAACCGCCAGGTCGCGGGCAGGCTGCACATCACGGTCAGC
ACGGTCGAGCAGCACCTCACCCGCATCTACCAGAAACTCGGCATCGGCCAGCGCGCCGAC
ATCGGGCAGCGGCTGAAGAGCCTGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [851-865]  1e-08 PR00038 [865-881]  1e-08 PR00038 [881-893]  1e-08 PR00038
PR00038   HTHLUXR
 [849-900]  5.40000000000001e-11 PF00196
PF00196   GerE
 [848-905]  1.70000295590054e-20 SM00421
SM00421   HTH_LUXR
 [844-909]  PS50043
PS50043   HTH_LUXR_2
 [865-892]  PS00622
PS00622   HTH_LUXR_1
IPR011990 Tetratricopeptide-like helical (Domain)
 [526-860]  4.2e-16 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [861-904]  1.99999999999999e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [829-908]  5.90000104995095e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-23]  0.192 Signal
Bacteria, Gram-negative   
TMHMM No significant hit