close all open/close all

CDS information : Tetrn_00040


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction5,425 / 6,216 / + [in whole cluster]
5,425 / 6,216 / + [in contig]
Location5425..6216 [in whole cluster]
5425..6216 [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative type II thioesterase
Gene
Gene (GenBank)tmn6
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative type II thioesterase]
MAPVPTQIPFDETWLRRFGTARQPDVRLVCLPHAGGAATTFFPLQRELPPSVEFVAVQYP
GRQDRRQEQPLRDVRTLADRVAAVLEPLTDLPIVLFGHSMGAVVGFETAARLEEKGANAP
IGLVASGRHSPATPRVENVHQRDDDGLIAEITTLSGTDPQILADPDMRAMILPALRADYT
AVETYEYDRGFVLRCPISVFTGTSDPRVTEHEAAAWESLTSGAFRIERFPGGHFYLEGAE
RAVATALMRDVRAFSATTTTPPR
selected fasta
>putative type II thioesterase [putative type II thioesterase]
ATGGCCCCGGTGCCCACACAGATACCGTTCGACGAGACGTGGCTGCGCCGCTTCGGCACG
GCCCGGCAGCCGGACGTGCGGCTTGTCTGTCTGCCCCACGCGGGCGGCGCGGCGACCACG
TTCTTCCCGCTGCAGCGTGAACTGCCGCCGTCCGTCGAGTTCGTGGCCGTGCAGTACCCG
GGCCGGCAGGACCGCCGCCAGGAACAGCCGCTGCGCGACGTCCGCACCCTCGCGGACCGC
GTGGCGGCCGTGCTCGAACCGCTGACCGATCTGCCGATCGTCCTCTTCGGGCACAGCATG
GGCGCGGTCGTCGGCTTCGAGACCGCAGCCCGGCTGGAGGAGAAGGGCGCCAACGCACCC
ATCGGCCTGGTCGCCTCGGGCCGGCACTCGCCGGCGACGCCGCGCGTGGAGAACGTGCAC
CAGCGCGATGACGACGGCCTCATCGCCGAGATCACCACGCTGAGCGGCACCGACCCGCAG
ATCCTGGCCGACCCGGACATGCGGGCCATGATCCTGCCGGCGCTGCGCGCCGACTACACC
GCCGTGGAGACGTACGAGTACGACCGCGGCTTCGTGCTGCGCTGCCCGATCAGCGTCTTC
ACGGGCACCTCGGACCCGCGGGTGACCGAGCACGAGGCGGCGGCCTGGGAGTCGCTGACC
TCCGGCGCGTTCCGCATCGAGCGGTTCCCCGGCGGCCACTTCTACCTCGAAGGTGCGGAG
CGGGCCGTCGCGACCGCCCTCATGCGCGACGTCCGCGCGTTCTCGGCCACGACCACGACG
CCGCCCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [27-243]  5.79999999999997e-50 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit