close all open/close all

CDS information : Tetrn_00060


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction6,469 / 7,347 / + [in whole cluster]
6,469 / 7,347 / + [in contig]
Location6469..7347 [in whole cluster]
6469..7347 [in contig]
TypeCDS
Length879 bp (292 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyltransferase
Product (GenBank)putative 2-oxoacid dehydrogenases acyltransferase
Gene
Gene (GenBank)tmn7
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q0R4L6
NITE
Chth_00380
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
ACC
B5L6L6
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative acyltransferase [putative 2-oxoacid dehydrogenases acyltransferase]
MSVARFPAERRHTLYHCDEIRETAPVFLDTEVDMSRVQEHRAAARHDGRRYSVVSYVLRA
SGSVLARHPDANAAIRGRLRPKVARYATVGGKVTLDKTLGGRRVVLSSVVPGLERSSLDD
VQQHVDRLRDGDPESMPEFEAVRKLHRLPVPVGRTLFRLATRSFAHRPELRGTVAVTSLG
HRAVDSFHSVGGTTVTLGLGRIVDRPVVRDGAVAVAPVMRLSLAFDHRVIDGAEAADVLS
ELKDFLEAYGPEAAPEAAGAGETASAGEPAAREEAVHEAVDARDPASPAPGP
selected fasta
>putative acyltransferase [putative 2-oxoacid dehydrogenases acyltransferase]
GTGAGCGTCGCCCGCTTCCCCGCCGAGCGCCGCCACACGCTCTACCACTGCGACGAGATA
CGGGAGACGGCGCCGGTCTTCCTCGACACCGAGGTGGACATGAGCCGGGTGCAGGAGCAC
CGGGCGGCCGCCCGGCACGACGGCCGCCGGTACTCGGTCGTCTCGTACGTCCTGCGCGCC
TCCGGCAGCGTGCTGGCCCGGCACCCGGACGCCAACGCGGCCATCCGCGGCCGGCTCCGC
CCCAAGGTCGCGCGCTACGCGACCGTCGGCGGCAAGGTGACGCTCGACAAGACGCTGGGC
GGGCGCCGCGTGGTGCTGTCCTCCGTCGTGCCGGGGCTGGAGCGGTCGAGCCTGGACGAC
GTGCAGCAGCACGTGGACCGGCTGCGCGACGGAGACCCCGAGTCCATGCCGGAGTTCGAG
GCGGTCCGCAAGCTGCACCGGCTGCCCGTGCCCGTCGGCCGCACCCTGTTCCGGCTGGCG
ACGCGGTCGTTCGCGCACCGCCCGGAGCTGCGGGGCACCGTGGCCGTCACCTCGCTGGGC
CACCGCGCGGTGGACAGCTTCCATTCGGTCGGCGGCACGACGGTCACGCTGGGCCTCGGG
CGGATCGTCGACCGCCCGGTGGTCCGGGACGGCGCCGTCGCCGTGGCGCCGGTGATGCGC
CTGAGCCTCGCCTTCGACCACCGGGTGATCGACGGGGCGGAGGCGGCCGACGTGCTGTCC
GAGCTGAAGGACTTCCTGGAGGCGTACGGGCCGGAGGCCGCCCCCGAGGCGGCAGGCGCC
GGGGAGACGGCCTCCGCCGGGGAGCCCGCTGCCCGGGAGGAGGCCGTGCACGAGGCGGTC
GACGCCCGCGACCCGGCCTCGCCCGCCCCGGGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001078 2-oxoacid dehydrogenase acyltransferase, catalytic domain (Domain)
 [171-248]  1.3e-17 PF00198
PF00198   2-oxoacid_dh
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [20-248]  1e-35 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit