close all open/close all

CDS information : Tetrn_00070


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction22,142 / 7,524 / - [in whole cluster]
22,142 / 7,524 / - [in contig]
Locationcomplement(7524..22142) [in whole cluster]
complement(7524..22142) [in contig]
TypeCDS
Length14,619 bp (4,872 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
GenetmnAI
tmnA1
Gene (GenBank)tmnA1
EC number
Keyword
Note
Note (GenBank)
  • loading module (KS-Q, AT-A, and ACP); module 1 (KS, AT-A, DH, KR, and ACP); module 2 (KS, AT-A, DH, ER, KR, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 malonyl-CoA
2 malonyl-CoA
KSQ20..387
AT568..887
ACP955..1028
KS1049..1424
AT1576..1862
DH1961..2126
KR2429..2609
ACP2714..2788
KS2810..3185
AT3335..3617
DH3706..3870
ER4121..4420
KR4430..4610
ACP4710..4780

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MWTVSEPAAQALARPEGPAPIAVVGTACRLPQADTPEAFWELLRDGRDAVTGLPDGRPDL
HAPGEAPGRARSGAFLDHVDLFDPAFFGIGPREAAAMDPQQRLVLELAWETLERTGIVPA
SLAGTRTGVFVGAMADDYARLTQQLGPAAVGQHTATGLHRGIIANRVSYLLGLTGPSMSV
DTGQSSSLTAVHLACESLLRGEADLALAGGVSLNLTADGYEITEAFGALSPDGRCHTFDA
RANGYVRGEGGGLVLLKRLSDALDDGDRVLGVILGSAVNNDGTTDTLTTPGARGQTDLLR
LACDRAGVAPGDIQYVELHGTGTRLGDPVEATALGEALGAGRGDADRLRVGSAKTNVGHL
EGAAGITGLIKTLLSLHHRELPRSLHFRAANPAIPLAGLGLRVQEEHGPWPDGDRRLIAG
VSSFGMGGANAHVVVAEPPSHSPDEEDAGRIPADAGRAPVAAAGVLPFLLSARSAAALRA
QARRLHDHLTARGDVATPLDVARALFTTRSAFEYRAAVLPALTTAEATAPAAEGSHDALL
AGLAALADDTPASGILRGTVRDGRVAHLFAGQGSQRAGMGSELYATWPVFRAALDELCTA
LDVALAPYVDRPLRDVMFADDDPELHRTVYAQPALFAFEVALFRLLESWGVRPDVVAGHS
IGELAAAHVAGVLTLPDACRLVAARGGLMQALPEGGAMLSVRAPADDVEALLTGSDALAG
LDIAAVNGPAATVVSGDAEAVDRMAAACAERDWKTRRLRVSHAFHSAHMDGMLADFAAVA
ADLDFRPPRIPIVSNLDGQEVGADEICDPGYWVRHVRRTVRFHEGVRWLGAAGVTTLVEI
GPDGVLSAMAKDCLPNAVTVPLRRGGTPEAREVLTAVVRAHLHGVAVDWSAVFQGAGTGH
VDLPTYAFQRERHWLTGEKQTAAVRPTAGPGEARTEAPLPPATTTPATVGSDAGLSRTLA
LVVGEAAGVLGYADASAVEVRRAFRDLGFDSISAVTLRDRLADATGLDLPSSVLFDHPTP
ERLAAHLHARLTGADDGVATTATAVDADDPVVVVGMACRYPGGVTSPAELWEMVWSGREG
ISEFPVDRGWGADLFDADPGKSGKSYARHGGFLHDAGEFDAEFFGVSPREALAMDPQQRL
VLEASWEACERAGIDPDSLRGSRTGVYIGATAQEYGPRLADGHDGHDGHLLTGTTVSVLS
GRVAYAFGLEGPAVTIDTACSSSLVAVHLAAQALRNGECDRALVGGVTVMGSPGMFLEFS
RQRGLSPDGRCKAFAEGADGTGWAEGVGLLLVERLSEARRQGHEVLAVLRGSAVNQDGAS
NGLTAPNGPSQQRVIQQALASAGLSAGQVDAVEAHGTGTKLGDPIEAQALLATYGREHSA
EQPLWLGSLKSNIGHTQAAAGVAGVIKMVEAMRRGGLPRTLHVDQPTTHVDWDAGAVALL
TEAREWPETGEPRRAAVSSFGISGTNAHVILEAPAEEERAPAGESGSDRLPVVPWVVSAR
SAEALRAQAARLGEFVARAGGEVSPVDVGTALLSRATGDYRAVVTGSGTEELTRALARVA
ADGSERASAAAGGVGFLFTGQGAQWPGMGSGLTGFPVFREAFEEVCGGFDGLLSRPLGEV
LADAGGDGLIHRTEFTQAGLFAFEVAMFRQLRAWGVEPGVLVGHSVGELAAAHCAGVWSL
ADACRLVAARGRLMDALPPGGAMVSLRGSLDEVTALIEGCSRVDVAAVNGPLSVVVSGDE
GEIEGLVSRWEADGGKARRLRVSHAFHSPLIEPMLADFRRVAEEVEYHEPSLTVVSNVTG
EVAEAQTVCDPEYWVRHVRRAVRFADGVQAAARTGVSVFVEVGPARVLTAMGQECLPDEP
VNWIALSRAPREGDKESPIEQSAKANTEFAHEESRAAGDLMSGVGAAFSAGVPVDWRAVF
GGVRGRRVALPTYAFQRRRYWLSGPASNGDPAGLGLGAFGHGLLGAAVTSASSGAVVLTG
RISRAGDGWLTGHRIQGRVLVPGAALVEMALRAGDEAGCPVLDDLTLEAPLELPETGGVQ
IQVTVDPAEDGEPARTVIVHARPDDGTDGPFIRHATGRLTPATDDTAGEPWQGAWPPPGG
EAVDLAGAYDLLAEQGYEYGSGFRGLTALWRDGSTRYAEVVLPEEHTGEHGPDAFGLHPA
LLDAALHTLLVDTGDVQDAGIRVPFSWSKVALHATAATHLRVKAVPAGPDTVAITLFDAE
GGPVAEVGELTMRTLAAETQPAADLYTLRWTPQQLPGDVPDLASWAALGATAPVPDTPAR
HYASLADILATDDQPTAVVYVPAPGGTTPTAAHTAVNDLLTLLQQHLAEPRLADTPLVVL
TRHAHTAEPDPVHAALWGLARTAQTEQPGRIHLLDTDDHPDTRTHLPRALAEALKTPQLA
LHVGTPHTPHLTHLPPQGDAGRALGRRNGTVLITGGAGALGGLVARHLAAEHGVRHLLLA
GRRGIDTPGAPELQEQLRAAGAEATFARCDLTDRDAVARMLAGIPDDRPLTAVVHAAGVV
ADATIASLTPETLREVLAPKVDAATHLDELTRDLDLDAFVLFSSIAGVLGTPGQGNYAAA
NAWLDALAARRRARGQAGQALAWGLWGDVGGSGGMGAALGEAELARWSRSGIAPLTPELG
LASLDAALRTRTPNVIPVRMDLPALRAQAEVGEVPYLLRDFAPRRRARRVAAAGTATGTS
ALAGRLAALDAAAQDAELLALVRTQAALVLGHDDAAHVDAEQDFKALGFDSLTAVELRNR
VNSAAGVRLAPTVVFNHPTPARLARHLRDEVLGAATASAAVPVTAVDADDPVVVVGMACR
YPGGVTSPAELWELVWSGREGISEFPVDRGWGADLFDADPGKSGKSYARHGGFLHDAGEF
DAEFFGVSPREALAMDPQQRLVLEASWEACERAGIDPDSLRGSRTGVYVGVMYHDYAPRM
STERQEIEGYALTGNLSSVLSGRVAYAFGLEGPAMTIDTACSSSLVALHLAAQAMRNGEC
DRALVGGVTVMATPNTFVEFSRQRGLSPDGRCKAFAEGADGTGWSEGVGLLLVERLSEAR
RQGHEVLAVLRGSAVNQDGASNGLTAPNGPSQQRVIQQALASAGLSAGQVDAVEGHGTGT
KLGDPIEAEALLATYGREHSDERPLWLGSIKSNLGHTQAAAGVAGVIKMVEAMRRGALPQ
TLHVDEPSTHVDWDAGAVALLTEAREWPETGEPRRAAVSSFGISGTNAHVILEQPADEPV
RGESGAGDLPVVPWVVSARSAEALRAQAERLGEFVARAGGEVSPVDVGTALLSRSAGEYR
AVVVGSDADELRAGLALVAEGDASPVATGGSVGLLFTGQGAQWPGMGSGLTGFPVFREAF
EEVCGGFDGLLSRPLGEVLADAGGDGLIHRTEFTQAGLFAFEVAMFRQLRAWGVEPGVLV
GHSVGELAAAHCAGVWSLADACRLVAARGRLMDALPPGGAMVSLRGSLDEVTALIEGCSR
VDVAAVNGPLSVVVSGDEGEIEGLVSRWEADGGKARRLRVSHAFHSPLIEPMLADFRRVA
QDIEYHEPSLTLVSNVTGEVAEAATVCDPEYWVRHVREAVRFADGVQAAASTGVSTFVEV
GPAPVLTAMGQECLPDEPLHWIALSRAPRDEEPGEAAVSRAAAVLMSGVGSAYAAGVPVD
WRAVYGAARAPRVALPTYAFQRRRYWLSGPVFAGDPAGLGLGASGHGLLGAAVTSASSGA
VVLTGRVSRAGDGWLTGHRIQGRVLVPGAALVEMALRAGDEAGCPVLDDLTLEAPLELPE
TGGVQIQVTVDPAEDGEPARTVIVHARPDDGTDGPFIRHATGRLIAADDTAGEPWQGAWP
PAGGEAVDLAGAYDLLAEQGYEYGSGFRGLTALWQDGSTRYAEVVLPEEHTGEHGPDAFG
LHPALLDAALHTLLVDTGDVQDAGIRVPFSWSKVALHATAATHLRVKAVPAGPDTVAISL
YDTQGGLVAEVGELTLRTLPAGAQPTGIPEHLYALRWTPQQLPHDVPDLADWAVLGTAAL
QDTPARHYASLADLLATDDQPTAVVYTPAPGGTTPTAAHTAVNDLLTLLQQHLTEPRLAD
TPLVVLTRHAHALPTDADPATDPAHTALWGLARSAQAEHPGRIHLLDTDDHPDTRTHLPR
ALAEALNTPQLVLHHGTPHTPLIMGSEGAGVVTEVGPGVTDLVPGDRVMGLLPHSFGPLA
VADRRMLAPMPAGWTFAQPRPVPVVFLTAYYGLRDLGRLEKGDSVLVHAATGGVGMAAVQ
LARHWGAEVYATASPPKQELLRELGLPEERIASSRDLDFAERFRRASGGAGMDVVLNSLA
REFVDASLELLGESGRFVEMGKTDIRDAAGVTERHPGVAYRAFDLMEAGPDRIREMLAEI
VALLESDVLTPLPLRTWDVRRAPEAYRFMSQARHVGKIVLTVPAPPDPAGTVLVTGGTGA
LGAQVARHLATVHGVRHLLLTSRRGMDAPGAAELRAELAGLGADATVAACDVSRREDVVR
LLAAVPAEHPLTAVVHAAGVTADGTVETLNAAAVDRVLAPKVDAVAHLDELTRGLDLSGF
TLFSSIAGTLGTAGQGNYAAANAWLDGLAQHRQALGHPAASLAWGYWAEESELSGHLSDA
DVARLSRTGILPLATAEGLDLLDEAVALGDAAVVPARLSTRAEEGVEVPAVLRQVVRPAR
RTAAADDPSASGGSGARLTELPAAERAEALVRLVRTHAAAVLGHGSANSVPRDAAFKTIG
FDSLAAVELRNRLNAAAGLRLPATAVFDNPTAEALAALIDGELPGAPATAEPADARAGSL
GELEEKLAAGAFDEQEQARLAKRLKALLWQIEDARPAGGEDAAPADAAPGGGLDVASDEE
MFAMIDRELGRD
selected fasta
>polyketide synthase [type I polyketide synthase]
GTGTGGACAGTGTCGGAACCGGCGGCCCAGGCCCTCGCGCGACCGGAAGGCCCGGCACCC
ATCGCCGTGGTCGGGACGGCCTGCCGTCTCCCGCAGGCCGACACACCCGAGGCGTTCTGG
GAGCTGCTGCGCGACGGCCGCGACGCCGTCACCGGCCTCCCCGACGGGCGCCCCGACCTG
CACGCGCCCGGCGAGGCGCCGGGAAGGGCCCGCAGCGGCGCGTTCCTCGACCACGTCGAC
CTCTTCGACCCCGCGTTCTTCGGCATCGGCCCGCGCGAGGCCGCCGCCATGGACCCGCAG
CAGCGCCTCGTGCTGGAGCTGGCGTGGGAGACGCTGGAACGGACCGGCATCGTGCCCGCG
TCGCTCGCCGGCACCCGCACCGGCGTGTTCGTCGGCGCCATGGCCGACGACTACGCCCGG
CTCACCCAGCAGCTCGGCCCCGCGGCCGTCGGCCAGCACACCGCCACCGGCCTGCACCGC
GGCATCATCGCCAACCGCGTCTCGTACCTCCTCGGCCTCACCGGCCCCAGCATGTCGGTC
GACACCGGGCAGTCCTCCTCGCTCACCGCCGTGCACCTCGCCTGCGAAAGCCTGCTGCGC
GGCGAGGCGGACCTCGCGCTCGCCGGCGGCGTCAGCCTCAACCTCACCGCCGACGGCTAC
GAGATCACCGAGGCGTTCGGCGCCCTGTCGCCAGACGGCCGCTGCCACACCTTCGACGCC
CGCGCCAACGGCTACGTACGCGGCGAGGGCGGCGGCCTCGTACTGCTCAAGCGGCTCTCC
GACGCCCTCGACGACGGCGACCGGGTGCTCGGCGTCATCCTCGGCAGCGCCGTCAACAAC
GACGGCACCACGGACACCCTCACCACCCCCGGCGCCCGGGGCCAGACCGACCTGCTGCGG
CTGGCCTGCGACCGCGCCGGCGTCGCCCCAGGCGACATCCAGTACGTCGAACTGCACGGC
ACCGGCACCCGGCTCGGCGACCCCGTCGAGGCGACGGCGCTCGGCGAGGCCCTGGGCGCC
GGCCGCGGCGACGCGGACCGGCTGCGCGTCGGCTCCGCCAAGACCAACGTCGGCCACCTG
GAGGGCGCGGCCGGCATCACCGGCCTGATCAAGACCCTGCTGAGCCTGCACCACCGCGAG
CTGCCCCGCAGCCTCCACTTCCGCGCCGCCAACCCCGCGATCCCGCTCGCCGGCCTCGGG
CTGCGGGTGCAGGAGGAGCACGGCCCCTGGCCGGACGGCGACCGGCGGCTGATCGCCGGG
GTCAGCTCGTTCGGGATGGGCGGCGCGAACGCGCACGTGGTGGTGGCGGAACCGCCGTCG
CACAGCCCGGACGAAGAGGACGCCGGTCGCATCCCCGCGGACGCGGGCCGGGCGCCCGTC
GCCGCCGCCGGGGTGCTGCCCTTCCTCCTCTCCGCCCGCAGCGCCGCCGCCCTGCGGGCG
CAGGCGCGCCGGCTGCACGACCACCTGACCGCGCGAGGCGACGTCGCCACCCCCCTCGAC
GTCGCCCGCGCCCTCTTCACCACCCGCTCGGCCTTCGAGTACCGGGCCGCGGTCCTCCCC
GCCCTCACCACCGCGGAGGCGACGGCCCCCGCCGCGGAGGGGAGCCACGACGCCCTCCTG
GCGGGTCTCGCGGCACTCGCCGACGACACCCCCGCCTCCGGCATCCTGCGCGGCACCGTC
CGCGACGGCCGCGTCGCGCACCTCTTCGCCGGCCAGGGCAGCCAGCGCGCCGGCATGGGC
AGCGAGCTGTACGCGACCTGGCCGGTCTTCCGCGCCGCACTCGACGAGCTGTGCACCGCC
CTCGACGTCGCGCTCGCGCCGTACGTCGACCGCCCCCTGCGCGACGTGATGTTCGCCGAC
GACGACCCGGAGCTGCACCGCACGGTCTACGCGCAGCCGGCGCTCTTCGCCTTCGAGGTC
GCCCTCTTCCGGCTGCTGGAGAGCTGGGGGGTGCGCCCCGACGTGGTGGCAGGACACTCC
ATCGGCGAACTCGCCGCCGCCCACGTCGCCGGCGTACTCACCCTGCCCGACGCCTGCCGC
CTGGTCGCCGCACGCGGCGGGCTCATGCAGGCGCTGCCGGAGGGCGGCGCGATGCTGTCC
GTCCGCGCACCCGCCGACGACGTCGAGGCACTCCTCACCGGGTCGGACGCCCTCGCAGGG
CTGGACATCGCCGCGGTCAACGGCCCCGCGGCCACCGTCGTTTCGGGCGACGCAGAGGCC
GTCGACCGCATGGCCGCGGCGTGCGCGGAGCGGGACTGGAAGACGCGCAGGCTGCGGGTG
AGCCACGCCTTCCACTCCGCGCACATGGACGGCATGCTCGCCGACTTCGCGGCCGTCGCC
GCCGATCTGGACTTCCGCCCGCCGCGCATCCCGATCGTGTCCAACCTCGACGGCCAGGAG
GTCGGCGCCGACGAGATCTGCGACCCCGGCTACTGGGTGCGGCACGTCCGCAGGACCGTC
CGCTTCCACGAAGGGGTGCGCTGGCTGGGCGCGGCCGGCGTCACCACGCTCGTGGAGATC
GGCCCCGACGGCGTCCTGTCCGCCATGGCCAAGGACTGCCTGCCGAACGCCGTGACCGTA
CCCCTGCGCCGCGGCGGCACGCCCGAAGCCCGCGAGGTGCTGACCGCGGTCGTACGGGCC
CACCTGCACGGCGTGGCCGTCGACTGGTCCGCCGTCTTCCAGGGCGCGGGCACCGGGCAT
GTCGACTTGCCGACGTACGCGTTCCAGCGCGAACGGCACTGGCTGACGGGGGAGAAGCAG
ACCGCGGCCGTGCGCCCGACCGCCGGCCCCGGCGAGGCGCGTACGGAAGCGCCGCTCCCT
CCGGCTACGACCACGCCCGCCACCGTCGGCTCAGACGCCGGCCTTTCGAGGACCCTGGCG
CTCGTCGTGGGCGAGGCCGCGGGCGTTCTCGGCTACGCCGACGCGTCGGCCGTCGAAGTG
CGGCGCGCCTTCCGCGACCTCGGCTTCGACTCGATCTCCGCCGTCACCCTCCGCGACCGG
CTGGCCGACGCCACCGGCCTCGACCTGCCCAGCTCCGTCCTCTTCGACCACCCCACCCCC
GAACGCCTCGCCGCCCACCTGCACGCCCGCCTCACCGGCGCCGACGACGGCGTCGCGACG
ACGGCCACCGCCGTGGATGCGGATGATCCGGTGGTGGTGGTGGGGATGGCGTGCCGGTAT
CCGGGTGGTGTGACGTCTCCTGCGGAGTTGTGGGAGATGGTGTGGTCGGGTCGTGAGGGT
ATTTCGGAGTTCCCCGTCGATCGCGGCTGGGGTGCCGATCTGTTCGATGCGGACCCGGGC
AAGTCCGGGAAGTCGTACGCCCGTCACGGGGGCTTCCTGCATGACGCGGGGGAGTTCGAC
GCGGAGTTCTTCGGCGTCTCCCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTG
GTGCTGGAGGCGTCGTGGGAGGCGTGCGAGCGTGCGGGCATCGACCCCGACAGCCTGCGC
GGCAGCCGCACCGGCGTCTACATCGGCGCCACCGCGCAGGAGTACGGGCCCCGCCTCGCG
GACGGCCACGACGGCCACGACGGGCACCTGCTCACCGGCACCACGGTCAGCGTGCTGTCG
GGGCGGGTGGCGTACGCCTTCGGGCTCGAAGGCCCGGCGGTGACGATCGACACGGCGTGC
TCGTCGTCGCTGGTCGCCGTCCACCTTGCGGCGCAGGCCCTGCGGAACGGGGAGTGCGAC
CGCGCGCTCGTCGGCGGCGTCACCGTCATGGGCTCTCCCGGGATGTTCCTGGAGTTCTCG
CGGCAGCGGGGGCTTTCGCCCGACGGCCGGTGCAAGGCGTTCGCGGAGGGTGCGGACGGT
ACGGGCTGGGCCGAGGGTGTCGGGCTGCTGTTGGTGGAGCGGTTGTCGGAGGCGCGGCGG
CAGGGGCACGAGGTGCTTGCGGTGCTGCGGGGTTCGGCGGTGAATCAGGATGGTGCGTCG
AATGGTCTGACGGCGCCGAACGGGCCGTCCCAGCAGCGGGTCATCCAGCAGGCCCTGGCC
AGCGCCGGACTCAGCGCAGGCCAGGTCGACGCCGTGGAGGCGCACGGGACCGGCACCAAG
CTCGGCGACCCCATCGAGGCACAGGCTCTGCTGGCGACGTACGGCCGGGAGCACTCGGCG
GAACAGCCGCTCTGGCTGGGGTCGCTGAAGTCCAACATCGGGCACACGCAGGCCGCAGCG
GGTGTCGCGGGCGTCATCAAGATGGTCGAGGCGATGCGGCGCGGGGGCCTTCCGCGCACG
TTGCACGTCGATCAGCCCACCACGCACGTGGACTGGGATGCGGGTGCGGTCGCGTTGTTG
ACGGAGGCGCGGGAGTGGCCGGAGACGGGGGAGCCGCGTCGTGCGGCGGTGTCGTCGTTC
GGTATCAGCGGGACGAACGCGCACGTGATCCTGGAGGCCCCCGCGGAGGAGGAGCGGGCG
CCTGCCGGGGAGTCCGGTTCGGACCGCCTTCCGGTGGTGCCGTGGGTGGTGTCGGCGCGT
AGCGCGGAGGCGTTGCGCGCGCAGGCGGCGCGGTTGGGGGAGTTCGTCGCCAGGGCCGGG
GGAGAGGTGTCCCCCGTCGATGTCGGGACGGCGCTGCTGTCGCGGGCGACGGGCGACTAC
CGGGCCGTGGTCACGGGCTCCGGCACCGAGGAGCTGACGAGGGCGCTGGCGCGGGTGGCG
GCGGACGGCTCCGAGCGGGCTTCTGCTGCGGCGGGCGGTGTCGGGTTCCTCTTCACCGGT
CAGGGTGCGCAGTGGCCGGGGATGGGGTCGGGGCTGACCGGTTTCCCGGTGTTCCGGGAG
GCGTTCGAGGAGGTCTGCGGCGGGTTCGACGGTCTGCTGAGCCGGCCGCTGGGTGAGGTG
CTCGCGGACGCGGGTGGCGATGGGCTCATTCATCGGACGGAGTTCACGCAGGCGGGGTTG
TTCGCGTTCGAGGTGGCGATGTTCCGTCAGCTTCGTGCGTGGGGTGTGGAGCCGGGTGTT
CTGGTCGGTCATTCGGTGGGTGAGCTGGCTGCGGCGCATTGCGCGGGTGTGTGGTCGCTT
GCGGATGCCTGCCGTCTGGTGGCTGCTCGTGGGCGGTTGATGGATGCGCTGCCGCCGGGT
GGTGCGATGGTGTCGCTGCGCGGCAGCCTGGACGAGGTCACCGCCCTGATCGAGGGCTGC
TCCCGGGTGGATGTGGCGGCGGTCAACGGGCCGTTGTCGGTGGTCGTTTCCGGTGATGAG
GGGGAGATCGAGGGGTTGGTGTCGCGTTGGGAGGCGGACGGCGGCAAGGCCCGCCGCCTC
CGGGTGTCCCACGCCTTCCACTCGCCGCTGATCGAGCCGATGCTCGCCGACTTCCGCCGG
GTGGCCGAGGAGGTCGAGTACCACGAGCCATCCCTGACGGTGGTCTCGAACGTCACGGGC
GAGGTCGCCGAGGCGCAGACGGTGTGCGATCCGGAGTACTGGGTTCGGCACGTTCGTAGA
GCCGTCCGCTTCGCGGATGGCGTGCAGGCGGCGGCTCGTACCGGGGTCTCCGTATTCGTG
GAGGTCGGGCCCGCCCGCGTCCTGACCGCCATGGGACAGGAATGCCTCCCGGACGAGCCC
GTCAATTGGATCGCCCTCTCCCGCGCTCCCCGGGAAGGCGACAAGGAATCGCCGATCGAA
CAATCTGCGAAGGCAAACACCGAATTTGCCCACGAGGAATCTCGTGCCGCCGGTGACCTC
ATGTCAGGCGTCGGCGCCGCGTTCTCGGCGGGCGTGCCGGTGGATTGGCGTGCGGTGTTC
GGCGGGGTCCGGGGGCGGCGGGTCGCGCTGCCGACGTACGCGTTCCAGCGGCGCCGCTAC
TGGCTGTCCGGCCCGGCGTCGAACGGCGATCCGGCGGGCCTGGGCCTGGGTGCGTTCGGG
CACGGGCTGCTGGGTGCCGCGGTGACGTCCGCGTCGTCGGGTGCGGTGGTGCTGACGGGT
CGTATTTCCCGTGCCGGTGACGGCTGGCTGACCGGGCACCGCATCCAGGGTCGTGTGCTG
GTGCCGGGCGCTGCGTTGGTGGAGATGGCGCTGCGGGCGGGGGACGAGGCCGGGTGCCCG
GTCCTCGACGACCTCACCCTGGAAGCGCCGTTGGAACTGCCCGAAACGGGCGGCGTGCAG
ATCCAGGTCACTGTCGACCCCGCGGAAGATGGGGAGCCGGCGCGTACGGTCATCGTGCAC
GCTCGTCCGGACGACGGTACGGACGGTCCGTTCATCCGGCACGCCACCGGCCGCCTCACC
CCCGCGACCGACGACACCGCTGGCGAGCCGTGGCAGGGCGCGTGGCCGCCCCCGGGGGGC
GAGGCCGTAGACCTGGCCGGGGCTTACGACCTGCTGGCCGAGCAGGGTTACGAGTACGGC
TCCGGTTTCCGCGGCCTGACGGCGCTGTGGCGTGATGGCTCGACGCGTTACGCGGAGGTC
GTGCTTCCCGAGGAGCACACCGGCGAGCACGGGCCCGACGCCTTCGGCCTGCACCCCGCC
CTCCTCGACGCCGCACTCCACACCCTCCTCGTCGACACCGGCGACGTCCAAGACGCCGGT
ATCCGGGTGCCGTTCTCGTGGTCCAAGGTCGCGCTCCACGCCACCGCGGCCACCCACCTG
CGCGTCAAAGCCGTCCCCGCCGGCCCCGACACCGTCGCGATCACGCTCTTCGACGCCGAA
GGCGGTCCGGTCGCAGAGGTCGGCGAGCTGACGATGCGTACCCTCGCGGCCGAGACCCAG
CCCGCCGCCGACCTCTACACCCTGCGCTGGACTCCGCAGCAACTCCCGGGCGACGTACCG
GACCTCGCCAGCTGGGCCGCCCTCGGCGCCACCGCACCCGTCCCGGACACCCCCGCCCGG
CACTACGCGAGCCTGGCCGACATCCTCGCCACCGACGACCAGCCCACCGCCGTCGTCTAC
GTACCCGCCCCCGGCGGCACCACCCCCACCGCCGCCCACACGGCCGTCAACGACCTCCTC
ACCCTCCTCCAGCAACACCTCGCAGAACCCCGCCTGGCCGACACCCCACTCGTCGTCCTC
ACCCGCCACGCCCACACCGCAGAGCCCGACCCGGTCCACGCGGCGCTGTGGGGCCTGGCC
CGTACGGCGCAGACCGAGCAGCCGGGGCGTATCCACCTCCTCGACACCGACGACCACCCC
GACACCCGCACCCACCTCCCGCGGGCCCTCGCCGAGGCGCTGAAGACCCCCCAACTCGCC
CTCCACGTCGGCACCCCGCACACCCCGCATCTCACCCACCTGCCGCCCCAGGGCGACGCC
GGACGCGCACTCGGCCGCCGGAACGGCACCGTGCTCATCACCGGCGGGGCGGGGGCGCTG
GGTGGGCTGGTCGCGCGTCACCTGGCGGCCGAGCACGGCGTACGGCACCTGCTGCTCGCC
GGCCGCCGCGGCATCGACACGCCCGGAGCGCCCGAACTGCAGGAGCAGTTGCGGGCGGCC
GGCGCGGAGGCGACGTTCGCCCGCTGCGACCTCACCGACCGCGACGCCGTGGCGCGGATG
CTCGCCGGGATCCCCGACGACCGGCCGCTGACCGCTGTCGTCCACGCCGCGGGCGTCGTC
GCCGACGCCACGATCGCGTCCCTCACGCCCGAGACTCTGCGCGAAGTCCTGGCCCCCAAG
GTCGACGCCGCGACGCATCTCGACGAGCTGACGCGCGACCTCGACCTCGACGCCTTCGTC
CTCTTCTCCTCGATCGCCGGTGTCCTGGGCACCCCGGGGCAGGGCAACTACGCCGCGGCC
AACGCCTGGCTCGACGCCCTGGCCGCCCGCCGCCGGGCCCGCGGCCAGGCGGGACAGGCC
CTGGCGTGGGGCCTGTGGGGCGACGTCGGCGGCAGCGGCGGGATGGGCGCCGCGCTCGGC
GAGGCCGAGCTTGCGCGCTGGAGCCGCAGCGGCATCGCCCCGCTGACGCCGGAACTGGGG
CTCGCGTCCCTCGACGCGGCGCTGCGCACCCGTACGCCCAACGTCATCCCCGTACGCATG
GACCTCCCCGCGCTCCGCGCACAGGCCGAGGTCGGCGAGGTGCCGTATCTCCTGCGGGAC
TTCGCACCCCGCCGCCGTGCCCGCCGGGTGGCGGCCGCGGGCACGGCGACCGGCACGTCC
GCCCTCGCCGGCCGGCTGGCGGCTCTCGACGCGGCGGCACAGGACGCCGAACTGCTCGCA
CTCGTCCGTACCCAGGCCGCGCTGGTCCTCGGCCACGATGACGCGGCGCACGTCGACGCC
GAGCAGGACTTCAAGGCGCTCGGCTTCGACTCCCTGACCGCGGTCGAACTGCGCAACCGC
GTCAACTCCGCGGCAGGCGTGCGCCTCGCCCCCACGGTCGTCTTCAACCACCCCACGCCC
GCGCGCCTCGCCCGCCACCTGCGCGACGAAGTCCTCGGCGCCGCCACCGCCTCCGCCGCC
GTGCCCGTGACCGCCGTGGATGCGGATGATCCGGTGGTGGTGGTGGGGATGGCGTGCCGG
TATCCGGGTGGTGTGACGTCTCCTGCGGAGTTGTGGGAGTTGGTGTGGTCGGGTCGTGAG
GGGATTTCGGAGTTCCCTGTCGATCGCGGTTGGGGTGCCGATCTGTTTGACGCCGACCCG
GGCAAGTCCGGGAAGTCGTACGCCCGTCACGGGGGCTTCCTGCATGACGCGGGGGAGTTC
GACGCGGAGTTCTTCGGTGTGTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGG
TTGGTGCTGGAGGCGTCGTGGGAGGCGTGCGAGCGTGCGGGCATCGATCCCGACAGCCTC
CGCGGCAGCCGCACCGGCGTGTACGTGGGCGTCATGTACCACGACTACGCGCCCCGCATG
TCGACCGAACGGCAGGAGATCGAGGGCTACGCGCTGACGGGGAACCTGTCGAGCGTGCTG
TCGGGGCGGGTGGCGTACGCGTTCGGGCTCGAAGGCCCCGCGATGACGATCGACACCGCG
TGCTCCTCGTCGCTCGTCGCGCTGCACCTTGCCGCCCAGGCGATGAGGAACGGCGAGTGC
GACCGGGCGCTCGTCGGCGGGGTCACCGTGATGGCGACGCCGAACACCTTCGTGGAGTTC
TCGCGGCAGCGGGGGCTTTCGCCCGACGGCCGGTGCAAGGCGTTCGCGGAGGGTGCGGAC
GGTACGGGCTGGAGCGAGGGTGTCGGGCTGCTGCTGGTGGAGAGGTTGTCGGAGGCGCGG
CGGCAGGGGCACGAGGTGCTGGCCGTGCTGCGGGGTTCGGCGGTGAATCAGGATGGTGCG
TCGAATGGTCTGACGGCGCCGAACGGGCCGTCCCAGCAGCGGGTCATCCAGCAGGCCCTG
GCCAGCGCCGGACTCAGCGCAGGGCAGGTCGACGCGGTCGAGGGCCACGGGACCGGCACC
AAGCTGGGCGATCCCATCGAGGCGGAAGCACTGCTCGCGACGTACGGCCGGGAGCACTCC
GACGAGCGGCCGCTGTGGCTCGGCTCGATCAAGTCGAACCTCGGGCACACGCAGGCCGCG
GCCGGTGTCGCGGGCGTCATCAAGATGGTCGAGGCGATGCGGCGCGGCGCGCTGCCGCAG
ACCCTCCACGTGGACGAGCCGAGCACGCACGTGGACTGGGATGCGGGTGCGGTCGCGTTG
TTGACGGAGGCGCGGGAGTGGCCGGAGACGGGGGAGCCGCGTCGTGCGGCGGTGTCGTCG
TTCGGTATCAGTGGGACGAACGCGCACGTGATCCTGGAGCAGCCGGCGGACGAGCCGGTG
CGCGGGGAGTCCGGTGCGGGCGACCTTCCGGTGGTGCCGTGGGTGGTGTCGGCGCGGAGC
GCGGAGGCGTTGCGCGCGCAGGCGGAGCGGTTGGGGGAGTTCGTCGCCAGGGCCGGGGGA
GAGGTGTCGCCGGTCGACGTCGGGACGGCGCTGCTGTCGCGATCGGCAGGCGAATACCGG
GCCGTGGTCGTCGGTTCCGACGCGGACGAACTCCGGGCCGGTCTGGCGCTGGTGGCCGAG
GGCGACGCCTCGCCGGTGGCGACGGGCGGCAGTGTCGGGCTGTTGTTCACCGGTCAGGGT
GCGCAGTGGCCGGGGATGGGGTCGGGGCTGACCGGTTTCCCGGTGTTCCGGGAGGCGTTC
GAGGAGGTCTGCGGCGGGTTCGACGGTCTGCTGAGCCGGCCGCTGGGTGAGGTGCTCGCG
GATGCGGGCGGCGATGGGCTCATTCATCGGACGGAGTTCACGCAGGCGGGGTTGTTCGCG
TTCGAGGTGGCGATGTTCCGTCAGCTTCGTGCGTGGGGTGTGGAGCCGGGTGTTCTGGTC
GGTCATTCGGTGGGTGAGCTGGCTGCGGCGCATTGCGCGGGTGTGTGGTCGCTTGCGGAT
GCCTGCCGTCTGGTGGCTGCTCGTGGGCGGTTGATGGATGCGCTGCCGCCGGGTGGTGCG
ATGGTGTCGCTGCGCGGCAGCCTGGACGAGGTCACCGCCCTGATCGAGGGCTGCTCCCGG
GTGGATGTGGCGGCGGTCAACGGGCCGTTGTCGGTGGTCGTTTCCGGTGATGAGGGGGAG
ATCGAGGGGTTGGTGTCGCGTTGGGAGGCGGACGGCGGCAAGGCCCGCCGCCTCCGGGTG
TCCCACGCCTTCCACTCGCCGCTGATCGAGCCGATGCTCGCCGACTTCCGCCGCGTCGCC
CAGGACATCGAGTACCACGAGCCGTCCCTGACGCTGGTTTCGAACGTCACGGGCGAGGTC
GCCGAGGCGGCGACGGTGTGCGATCCGGAGTACTGGGTCCGGCACGTGCGCGAGGCCGTC
CGCTTCGCGGACGGCGTACAGGCCGCGGCCAGCACGGGCGTCTCGACGTTCGTGGAGGTC
GGGCCCGCCCCCGTCCTGACCGCCATGGGACAGGAATGCCTCCCGGACGAACCCCTCCAC
TGGATCGCCCTCTCCCGCGCACCGCGCGACGAGGAGCCGGGCGAGGCTGCCGTCTCTCGT
GCCGCCGCCGTGCTGATGTCCGGCGTTGGCTCGGCCTACGCTGCGGGCGTGCCGGTGGAT
TGGCGCGCGGTCTACGGCGCGGCCCGGGCTCCGCGGGTCGCGCTGCCGACGTACGCGTTC
CAGCGGCGCCGCTACTGGCTCTCCGGTCCCGTCTTCGCGGGCGATCCGGCGGGCCTGGGC
CTCGGTGCGTCCGGGCACGGGCTGCTGGGTGCCGCGGTGACGTCCGCGTCGTCGGGTGCG
GTGGTGCTGACGGGTCGTGTCTCCCGTGCCGGTGACGGCTGGCTGACCGGGCACCGCATC
CAGGGTCGTGTGTTGGTGCCGGGTGCTGCGTTGGTGGAGATGGCGCTGCGTGCCGGTGAC
GAGGCCGGGTGCCCGGTCCTCGACGACCTCACTCTCGAAGCGCCGTTGGAGCTGCCCGAA
ACGGGCGGCGTGCAGATCCAGGTCACCGTCGACCCCGCGGAAGATGGGGAGCCGGCTCGT
ACGGTCATCGTCCACGCCCGTCCGGACGACGGTACGGACGGTCCGTTCATCCGGCACGCC
ACCGGCCGCCTCATCGCCGCCGACGATACGGCCGGCGAGCCGTGGCAGGGCGCGTGGCCG
CCCGCGGGGGGCGAGGCCGTAGACCTGGCCGGGGCTTACGACCTGCTGGCCGAGCAGGGT
TACGAGTACGGCTCCGGTTTCCGCGGCCTGACGGCGCTGTGGCAGGACGGCTCGACGCGT
TACGCGGAGGTCGTGCTTCCCGAGGAGCACACCGGCGAGCACGGGCCCGACGCCTTCGGC
CTCCATCCGGCCCTCCTCGACGCCGCACTCCACACCCTCCTCGTCGACACCGGCGACGTC
CAAGACGCCGGTATCCGGGTGCCGTTCTCGTGGTCCAAGGTCGCGCTCCACGCCACCGCG
GCCACCCACCTGCGCGTCAAAGCCGTCCCCGCCGGCCCCGACACCGTCGCGATCAGCCTG
TACGACACGCAGGGCGGCCTCGTGGCCGAGGTCGGCGAGCTGACCCTGCGCACGCTGCCC
GCTGGTGCCCAGCCGACCGGCATCCCCGAGCACCTCTACGCCCTGCGCTGGACTCCGCAG
CAACTCCCGCACGACGTACCGGACCTCGCCGACTGGGCCGTCCTCGGCACCGCCGCCCTC
CAGGACACCCCCGCCCGGCACTACGCGAGCCTGGCCGACCTCCTCGCCACCGACGACCAG
CCCACCGCCGTCGTCTACACACCCGCCCCCGGCGGCACCACCCCCACCGCCGCCCACACG
GCCGTCAACGACCTCCTCACCCTCCTCCAGCAACACCTCACGGAACCCCGCCTGGCCGAC
ACCCCCCTCGTCGTCCTCACCCGCCACGCCCACGCCCTGCCCACCGACGCCGACCCCGCG
ACCGACCCCGCGCACACCGCGCTGTGGGGTCTGGCGCGCTCCGCGCAGGCCGAGCACCCG
GGGCGTATCCACCTCCTCGACACCGACGACCACCCCGACACCCGCACCCACCTCCCGCGG
GCCCTCGCCGAGGCGCTGAACACCCCCCAACTCGTCCTCCACCACGGCACCCCGCACACC
CCCCTGATCATGGGCAGCGAGGGCGCCGGCGTCGTCACCGAGGTGGGCCCCGGCGTCACG
GACCTCGTGCCCGGCGACCGGGTAATGGGCCTGCTGCCGCACTCCTTCGGCCCGCTCGCG
GTCGCCGACCGGCGCATGCTCGCCCCGATGCCCGCGGGCTGGACGTTCGCACAGCCGCGG
CCCGTGCCCGTGGTCTTCCTCACCGCGTACTACGGCCTGCGCGACCTGGGCCGGCTGGAG
AAGGGCGACTCGGTGCTCGTGCACGCCGCCACCGGCGGCGTCGGCATGGCCGCCGTCCAG
CTGGCGCGGCACTGGGGCGCCGAGGTGTACGCCACCGCCAGCCCGCCGAAGCAGGAGCTG
CTGCGCGAGTTGGGGCTGCCGGAGGAGCGGATCGCCTCCTCGCGCGACCTCGACTTCGCC
GAGCGGTTCCGGCGTGCGTCCGGCGGCGCGGGCATGGACGTCGTCCTCAACTCGCTGGCC
CGCGAGTTCGTGGACGCCTCGCTCGAACTGCTCGGCGAGAGCGGCCGGTTCGTGGAGATG
GGGAAGACCGACATCCGCGACGCCGCCGGCGTCACGGAGCGGCACCCGGGGGTCGCGTAC
CGGGCGTTCGACCTGATGGAGGCCGGTCCTGACCGGATCCGCGAGATGCTCGCCGAGATC
GTCGCGCTGCTGGAGTCGGACGTGCTCACGCCGCTGCCGTTGCGCACCTGGGACGTGCGG
CGCGCGCCGGAGGCGTACCGCTTCATGAGCCAGGCCCGGCACGTCGGCAAGATCGTGCTG
ACCGTGCCGGCGCCGCCGGACCCCGCCGGGACGGTGCTGGTCACCGGCGGCACGGGCGCG
CTGGGCGCGCAGGTGGCGCGCCATCTGGCGACCGTTCACGGCGTACGGCACCTGCTGCTG
ACCAGCCGTCGCGGGATGGACGCGCCCGGGGCCGCGGAGCTGCGCGCCGAACTGGCCGGC
CTCGGGGCCGACGCCACCGTCGCGGCGTGCGACGTGTCGCGGCGCGAGGACGTGGTACGG
CTCTTGGCCGCCGTCCCGGCGGAGCACCCGCTCACCGCCGTCGTGCACGCTGCGGGCGTC
ACCGCCGACGGCACCGTCGAGACGCTCAACGCCGCCGCCGTCGACCGGGTGCTCGCCCCC
AAGGTGGACGCGGTCGCGCACCTGGACGAGCTGACCCGCGGCCTCGACCTCAGCGGCTTC
ACCCTGTTCTCGTCCATCGCCGGCACCCTCGGCACGGCAGGCCAGGGCAACTACGCCGCC
GCCAACGCCTGGCTGGACGGGCTGGCGCAGCACCGCCAGGCCCTCGGCCACCCGGCGGCC
TCGCTCGCCTGGGGCTACTGGGCCGAGGAGAGCGAGCTGTCCGGCCACCTCAGCGACGCG
GACGTGGCCCGGCTGAGCCGTACGGGCATCCTGCCGCTGGCCACCGCCGAGGGCCTCGAC
CTGCTGGACGAGGCCGTGGCGCTGGGCGACGCCGCCGTGGTACCGGCGCGGCTGAGCACG
CGCGCCGAGGAGGGCGTGGAGGTGCCCGCGGTGCTCCGGCAGGTCGTCAGGCCGGCGCGG
CGCACTGCCGCGGCGGACGACCCGTCCGCGTCCGGCGGTTCGGGGGCGCGGCTGACGGAG
CTGCCGGCGGCGGAGCGGGCCGAGGCGCTGGTCCGGCTGGTCCGTACGCACGCCGCGGCG
GTGCTCGGGCACGGCTCGGCGAACTCCGTGCCGCGCGACGCCGCGTTCAAGACCATCGGC
TTCGACTCGCTGGCCGCCGTGGAGCTGCGCAACCGGCTCAACGCCGCGGCCGGCCTCCGG
CTGCCCGCCACCGCCGTCTTCGACAACCCGACCGCGGAGGCGCTCGCCGCGCTGATCGAC
GGCGAACTCCCGGGCGCGCCCGCCACGGCGGAACCGGCCGACGCCCGGGCGGGGAGCCTC
GGCGAGCTGGAGGAGAAGCTGGCCGCGGGCGCGTTCGACGAGCAGGAGCAGGCGAGGCTC
GCCAAGCGGCTGAAGGCCCTGTTGTGGCAGATCGAGGACGCCCGCCCGGCCGGGGGAGAG
GACGCCGCCCCGGCGGACGCAGCGCCCGGCGGCGGGCTGGACGTGGCCAGTGACGAGGAG
ATGTTCGCGATGATCGACCGGGAGCTGGGCAGGGACTGA
[0] KSQ20..387
[0] AT568..887
[0] malonyl-CoA762..766
[0] ACP955..1028
[1] KS1049..1424
[1] AT1576..1862
[1] malonyl-CoA1764..1768
[1] DH1961..2126
[1] KR2429..2609
[1] ACP2714..2788
[2] KS2810..3185
[2] AT3335..3617
[2] malonyl-CoA3522..3526
[2] DH3706..3870
[2] ER4121..4420
[2] KR4430..4610
[2] ACP4710..4780
[0] KSQ58..1161
[0] AT1702..2661
[0] malonyl-CoA2284..2298
[0] ACP2863..3084
[1] KS3145..4272
[1] AT4726..5586
[1] malonyl-CoA5290..5304
[1] DH5881..6378
[1] KR7285..7827
[1] ACP8140..8364
[2] KS8428..9555
[2] AT10003..10851
[2] malonyl-CoA10564..10578
[2] DH11116..11610
[2] ER12361..13260
[2] KR13288..13830
[2] ACP14128..14340

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-692]  G3DSA:3.40.366.10 [762-875]  G3DSA:3.40.366.10 [1574-1694]  G3DSA:3.40.366.10 [1763-1869]  G3DSA:3.40.366.10 [3332-3452]  G3DSA:3.40.366.10 [3521-3629]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [986-1001]  PS00012 [2746-2761]  PS00012 [4738-4753]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1032]  1.6e-61 G3DSA:1.10.1200.10 [2717-2791]  1.6e-61 G3DSA:1.10.1200.10 [4708-4784]  1.6e-61 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [951-1065]  1.89999859865865e-27 SSF47336 [2711-2826]  9.10000425645573e-28 SSF47336 [4702-4797]  2.10000267834031e-22 SSF47336
SSF47336   ACP_like
 [955-1028]  PS50075 [2714-2788]  PS50075 [4710-4780]  PS50075
PS50075   ACP_DOMAIN
 [962-1027]  2.3e-12 PF00550 [2722-2787]  2.6e-13 PF00550 [4713-4779]  4.3e-09 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [4161-4277]  8.1000073432326e-15 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4253-4348]  1.9e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4156-4189]  1.7e-05 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2429-2608]  2.89999999999999e-61 PF08659 [4430-4609]  4.10000000000004e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [20-262]  1.69999999999998e-82 PF00109 [1049-1298]  5.59999999999999e-94 PF00109 [2810-3059]  1.20000000000001e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [270-387]  3.89999999999997e-37 PF02801 [1306-1424]  4.10000000000004e-46 PF02801 [3067-3185]  2.80000000000001e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [568-887]  1.9e-64 PF00698 [1576-1862]  3.99999999999998e-59 PF00698 [3335-3617]  8.00000000000001e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [564-856]  2.50000909916183e-75 SSF52151 [1573-1874]  1.50000965748778e-67 SSF52151 [3331-3632]  1.19999063421924e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-761]  8.90000829418053e-19 SSF55048 [1699-1763]  4.99999811956429e-16 SSF55048 [3457-3521]  4.99999811956429e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [20-273]  G3DSA:3.40.47.10 [275-440]  G3DSA:3.40.47.10 [1051-1310]  G3DSA:3.40.47.10 [1311-1477]  G3DSA:3.40.47.10 [2809-3069]  G3DSA:3.40.47.10 [3071-3236]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [11-440]  3.79997359309398e-89 SSF53901 [1041-1476]  9.69997533354407e-105 SSF53901 [2802-3237]  5.20000089003336e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2427-2596]  4.2e-70 G3DSA:3.40.50.720 [4205-4396]  3.80000000000003e-54 G3DSA:3.40.50.720 [4430-4611]  4.2e-70 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1211-1227]  PS00606 [2972-2988]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [568-866]  1.09999184471405e-126 SM00827 [1577-1871]  2.19999900980707e-113 SM00827 [3335-3631]  4.80002938964645e-116 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [959-1031]  2.70000183580794e-30 SM00823 [2719-2791]  8.90000829418053e-32 SM00823 [4711-4783]  3.0999994589937e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1961-2126]  2.80000504261099e-72 SM00826 [3706-3870]  1.69998802370953e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [21-440]  SM00825 [1051-1476]  SM00825 [2812-3237]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2429-2609]  5.29997329885557e-65 SM00822 [4430-4610]  2.69998997787809e-51 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4121-4420]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit