close all open/close all

CDS information : Tetrn_00080


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction22,932 / 22,261 / - [in whole cluster]
22,932 / 22,261 / - [in contig]
Locationcomplement(22261..22932) [in whole cluster]
complement(22261..22932) [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative DedA family membrane-associated protein
Gene
Gene (GenBank)tmn10
EC number
Keyword
Note
Note (GenBank)
  • 43% identity with alkaline phosphatase (protein_id: BAD41126.1)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative DedA family membrane-associated protein]
MILEPQVWAAAPADSSGNWATDLMESLGSPGVAIATGLESLFPTVPSELVLLLGGYTARL
GDLNFLALVCWSTIGSVVGSVLHYYVGALLGRRRTRAIFIRFPLVQESDLDRAEGWFARY
GAKAVLVGRLIPIVRSYVSLPAGIERMPVPLFTAYTAIGSLLWNLVLLTVGYAVGSSHDT
VEQYANGFTAVVGGLLLVLVARFVFVRLRARRRERRETPAEPV
selected fasta
>hypothetical protein [putative DedA family membrane-associated protein]
ATGATCCTCGAACCTCAGGTGTGGGCCGCCGCCCCGGCGGACAGCTCCGGCAACTGGGCC
ACCGACCTCATGGAGAGCCTCGGCTCTCCCGGCGTCGCCATCGCCACCGGCCTGGAAAGC
CTCTTCCCCACCGTGCCCAGCGAACTCGTGCTGCTGCTCGGCGGGTACACGGCCCGGCTC
GGCGACCTCAACTTCCTGGCCCTCGTGTGCTGGAGCACCATCGGATCCGTGGTCGGCTCC
GTCCTGCACTACTACGTCGGCGCGCTCCTCGGCCGGCGCCGCACCCGCGCCATCTTCATC
CGCTTCCCGCTGGTCCAGGAGTCCGACCTCGACCGCGCCGAGGGGTGGTTCGCCCGCTAC
GGCGCCAAGGCCGTGCTCGTCGGCCGGCTGATCCCCATCGTGCGCAGCTACGTCTCGCTC
CCCGCCGGCATCGAACGCATGCCGGTGCCGCTGTTCACGGCATACACGGCGATCGGCTCG
CTGCTGTGGAACCTCGTCCTGCTCACCGTCGGCTACGCCGTCGGCAGCAGCCACGACACC
GTCGAGCAGTACGCCAACGGGTTCACCGCCGTCGTCGGCGGCCTCCTCCTCGTACTCGTC
GCGCGGTTCGTCTTCGTCCGGCTGCGCGCCCGGCGCCGGGAGCGGCGCGAGACCCCGGCA
GAGCCGGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015414 SNARE associated Golgi protein (Family)
 [45-172]  1.3e-24 PF09335
PF09335   SNARE_assoc
SignalP
 [1-35]  0.11 Signal
Eukaryota   
 [1-35]  0.149 Signal
Bacteria, Gram-positive   
TMHMM
 [65-87]  Transmembrane (o-i) [152-174]  Transmembrane (i-o) [184-206]  Transmembrane (o-i)
Transmembrane 3