close all open/close all

CDS information : Tetrn_00090


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction23,602 / 23,030 / - [in whole cluster]
23,602 / 23,030 / - [in contig]
Locationcomplement(23030..23602) [in whole cluster]
complement(23030..23602) [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative ribosomal protein L15P
Gene
Gene (GenBank)tmn8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative ribosomal protein L15P]
MPALLSGARRLRPAVPPPEGKAVRPTEFPSRLTAAGAAAIALTVPIGASQAHAADTHKEE
CVTISFIEQLVTTETKDAAPVGPSVGDVVITEDAVLDDQRNRIGTNDIKGIIIKKDAATG
ELFSFSASEYTLDDGTIHVAGLVNLTALASGKEQKLPAYGTGGRYAGKVGELSWTLVSET
ESLNSIALCD
selected fasta
>hypothetical protein [putative ribosomal protein L15P]
GTGCCTGCTCTCCTGAGCGGTGCCCGGCGCCTTCGCCCAGCAGTACCACCACCAGAAGGG
AAAGCAGTGCGCCCTACAGAGTTCCCCTCCCGGCTGACCGCCGCCGGGGCCGCGGCCATC
GCGCTCACCGTGCCCATCGGCGCGAGCCAGGCCCACGCCGCGGACACGCACAAGGAAGAG
TGCGTGACCATCTCGTTCATCGAGCAGCTGGTCACCACCGAGACCAAGGACGCGGCTCCG
GTCGGTCCCAGCGTCGGCGACGTCGTGATCACCGAGGACGCGGTGCTGGACGACCAGCGC
AACCGCATCGGGACCAACGACATCAAGGGCATCATCATCAAGAAGGACGCCGCCACCGGC
GAGCTGTTCTCCTTCTCGGCCTCCGAGTACACCCTCGACGACGGCACCATCCACGTCGCG
GGCCTGGTCAACCTGACCGCGCTGGCCTCCGGCAAGGAGCAGAAGCTCCCGGCCTACGGC
ACCGGCGGCCGCTACGCGGGCAAGGTCGGCGAGCTGTCGTGGACCCTCGTCAGCGAGACC
GAATCGCTCAACTCCATTGCGCTCTGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-53]  0.992 Signal
Bacteria, Gram-positive   
 [1-53]  0.9 Signal
Bacteria, Gram-negative   
 [1-53]  0.934 Signal
Eukaryota   
TMHMM No significant hit