close all open/close all

CDS information : Tetrn_00100


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction25,254 / 23,752 / - [in whole cluster]
25,254 / 23,752 / - [in contig]
Locationcomplement(23752..25254) [in whole cluster]
complement(23752..25254) [in contig]
TypeCDS
Length1,503 bp (500 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative FAD-dependent monooxygenase
Gene
Gene (GenBank)tmn9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q58PK7
PmId
[16148009] Ablation of the otcC gene encoding a post-polyketide hydroxylase from the oxytetracyline biosynthetic pathway in Streptomyces rimosus results in novel polyketides with altered chain length. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative FAD-dependent monooxygenase]
MSEPVVVVGAGPAGLMLACELAMRDVPAVLVDIHPTQRAEAPAMAINAGTLEMLDQRGLA
AGLREGTVTFPEVRFADLRLAFEKVQGPREPTHMVLQSRLEKVLIDRAVELGVDLRWATR
LTGFEEAADGSGVTVTLASDAGEEQLRCRYLVGCDGRESIVRKQAGIDYVGDDWVIVRGI
VGDVAINREDVAPEQYGLSYTDNGDQFLGAPLSPDVMRVFSAEFSTEPPEFEDGPATLEQ
LGDAVKRLTGKELKATEAHWLQHYSIVTRNAEQYRKGRVFIAGDAAHVHYPYNGQGLGTA
IGDAVNLGWKIAAEVHGWAPADLLDSYHVERHLAGRLACMNIQAQLALLYPRPLARYMRE
MMGEFLKFDEVNVFLAEIVTNLGPAVPIAYEGVPEPVEGDRLLGRRLPKVQIKTADGDMG
VAETLQSGRGVLLDLSGDASAQEESGWPTASTWSAPKPGTDLPGTLLLRPDGCVAWHDGG
GWGQDELRTALRTWFGAPTG
selected fasta
>putative oxidoreductase [putative FAD-dependent monooxygenase]
ATGAGTGAGCCGGTCGTCGTCGTGGGCGCCGGGCCCGCCGGTCTGATGCTCGCCTGCGAG
CTGGCGATGCGCGACGTGCCCGCGGTCCTTGTGGACATCCACCCCACGCAGCGCGCCGAG
GCTCCGGCCATGGCGATCAACGCGGGCACGCTGGAGATGCTGGACCAGCGCGGCCTCGCC
GCCGGGCTGCGGGAAGGCACGGTCACGTTCCCCGAGGTGCGGTTCGCGGACCTGCGGCTG
GCCTTCGAGAAGGTGCAGGGGCCGCGTGAACCCACCCACATGGTGCTCCAGTCGCGGCTG
GAGAAGGTGCTGATCGACCGGGCCGTCGAGCTGGGCGTCGACCTGCGCTGGGCCACCCGC
CTCACCGGGTTCGAGGAGGCAGCGGACGGGTCCGGCGTCACCGTGACGCTCGCCTCCGAC
GCCGGCGAGGAGCAACTGCGCTGCCGGTACCTGGTCGGCTGCGACGGGCGGGAGAGCATC
GTCCGCAAGCAGGCCGGCATCGACTACGTCGGCGACGACTGGGTGATCGTACGCGGCATC
GTCGGCGACGTCGCGATCAACCGCGAGGACGTGGCGCCCGAGCAGTACGGCCTGTCCTAC
ACCGACAACGGCGACCAGTTCCTCGGCGCTCCGCTGAGCCCCGACGTCATGCGCGTGTTC
AGCGCCGAGTTCTCCACCGAGCCGCCGGAGTTCGAGGACGGCCCGGCGACGCTGGAGCAG
CTCGGCGACGCCGTCAAGCGACTGACCGGCAAGGAGCTGAAGGCCACCGAGGCGCACTGG
CTGCAGCACTACTCGATCGTCACCCGCAACGCGGAGCAGTACCGCAAGGGCCGCGTCTTC
ATCGCAGGCGACGCCGCGCACGTGCACTACCCGTACAACGGGCAGGGCCTCGGCACCGCC
ATCGGCGACGCGGTGAACCTCGGCTGGAAGATCGCCGCCGAGGTCCACGGCTGGGCGCCG
GCGGACCTGCTCGACTCGTACCACGTGGAGCGGCACCTCGCCGGCCGGCTCGCCTGCATG
AACATCCAGGCGCAGCTCGCCCTCCTCTACCCGCGCCCGCTGGCCCGCTACATGCGGGAG
ATGATGGGCGAGTTCCTGAAGTTCGACGAGGTGAACGTCTTCCTCGCCGAGATCGTCACC
AACCTCGGCCCCGCCGTCCCCATCGCCTACGAAGGCGTGCCGGAGCCCGTCGAAGGCGAC
CGGCTGCTCGGCCGGCGGCTGCCGAAGGTGCAGATCAAGACCGCGGACGGCGACATGGGC
GTCGCCGAGACCCTGCAGTCCGGCCGCGGTGTGCTGCTCGACCTGTCCGGTGACGCCTCC
GCGCAGGAGGAGAGCGGCTGGCCGACCGCGTCGACGTGGTCCGCGCCCAAGCCCGGTACC
GACCTGCCGGGCACCCTGCTGCTGCGCCCGGACGGCTGCGTCGCCTGGCACGACGGCGGC
GGCTGGGGCCAGGACGAGCTGCGCACCGCCCTGCGCACCTGGTTCGGCGCCCCGACCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [4-337]  1.39999999999997e-70 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [4-26]  1e-36 PR00420 [147-162]  1e-36 PR00420 [276-291]  1e-36 PR00420 [291-307]  1e-36 PR00420 [309-327]  1e-36 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit