close all open/close all

CDS information : Tetrn_00110


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction30,048 / 25,324 / - [in whole cluster]
30,048 / 25,324 / - [in contig]
Locationcomplement(25324..30048) [in whole cluster]
complement(25324..30048) [in contig]
TypeCDS
Length4,725 bp (1,574 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
GenetmnAVI
Gene (GenBank)tmnVI
EC number
Keyword
Note
Note (GenBank)
  • module 12 (KS, AT-A, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

12 malonyl-CoA
KS34..411
AT570..861
kr1197..1374
ACP1486..1556

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MSKEEKLVEYLKWVTAELHEAQQRLSVLETGDREPVAIVSMACRYPGGVRSPEDLWQLVA
DGSDAISGFPLNRGWELDGLFDADPDRSGTSYAREGGFLHDAAAFDAAFFEISPREATAT
DPQQRLLLEAAWETFERADLDPHSLRGSRTGVFAGVMYSDYVARLMDRLPPGFEGFLGNG
GAASVASGRVAYTFGLEGPAVTVDTACSSSLVSMHLAAQALRNEECDLALAGGVTVMATP
GVFVEFSRQRGLAPDGRCKPFAEAADGTGWGEGVGFVLLERLSDAERNGHEILAVLRGSA
VNQDGASNGLTAPNGPSQQRVIEQALASARLSAGQVDAVEAHGTGTTLGDPIEAQALLAT
YGQAHSAERPLWLGAVKSNIGHTQAAAGVAGVIKMVEAMRHGVLPRTLHVDEPSTHVDWN
TGHVALLTEAQQWPETGEPRRAAVSSFGISGTNAHVILEAAPEPGKPVEERVDKSMPVPV
VVSARSSAALAEAAGRLAAYVEHHPDVEIGALAARLWSGRAKLEHRAGVVTADPTELHEA
LTALAAGTTHPALVTGPGSAETGGRLAVMFSGQGSQRPGMGRDLYETFPAYAEALDEVCA
ALDQHLDTEVPLRDVMFAEPGSEHAALLETTLYTQPALFAHHVAGYRLLQKVGVQPAALI
GHSIGELSAAHLTGTLPLAVAADMVATRAKLLHTLPDGTGMLAVNTDADTLTPYLKRHED
VAVAAHNSATSLAVAGPHQPLRELAAELTEAGIRTKALKVAHAFHTAHTEPILDTFTGHL
TDLFNRHTLGDADIPVISNVTGLPATSGQHHDPEYWAQHIRQPVHFHQGITHLTTDDSIS
LFTELAPHPTLAPQLPSGTKRTPRLPTETLTHLATLVGLHGNHHPVDLAAHLPETAAKVP
ALPTYPFQHRPYWLRADPAKGTDARPGDAELWDALEREDLDGVLSAMGVRDADVTAWKAV
LPSLVTWRRQRGWGHRLGWEALDDGTPPLLDGAWVVLLPEDAAEHPAVRTALTALDEGGA
GVEVVTVERQMARTTFAGRLRAALSACGARLAGVLSLLAFADPARPGPDGLELSATLLHA
LDDAAAQVPVWFLTAGGTTAGGEDPLADPAQARIRGLAQSLAVEHPERWGGLADLPAGGA
GGRDVRDRLRAALAGRADRSGAREDQVAVRAGALFARRMRPADLAAATEPWLRATDGTVL
VTGAGGALAEEIAVQLVREGVRHLLLATGPGAYGEAAALVAQLREAGAEPVVAAIDLADR
DAVAALVRSVAPEHPLTAVVHVAAQLDDAVVGAVDADDVGRLLDPAAAALANLCELTLDR
GLESFVHCTSAVGALGAAGFGAQGAVHAHLEALAQTYRERGLPVTSVVCGPWQDPEAADT
AAGKHLRYQGIRPMAPRLAARLLVRAVAGRPATPVLVDVDWDRYVRQSEQGAAGSLLRAI
PEAGAGAGDGGAWEPETDGAGPLGEAAARLRQRLDTAAGAERAELLLELLRDAAAQVLGH
ADTGEIAADAQFTELGFSSFTALELCNRVAAVSGLEIPPMAIFDNPTPQALAGYLMTTFE
GETSLATAAGAAAR
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGTCCAAGGAAGAGAAGCTCGTCGAGTACCTCAAGTGGGTCACCGCCGAGCTGCATGAG
GCCCAGCAGCGGCTGTCCGTCCTGGAGACCGGGGACCGGGAGCCGGTGGCGATCGTGTCG
ATGGCCTGCCGGTACCCGGGCGGCGTGCGGTCGCCCGAGGACCTGTGGCAGCTCGTCGCG
GACGGCTCGGACGCCATCTCCGGCTTCCCCCTGAACCGCGGCTGGGAGCTGGACGGACTC
TTCGACGCAGACCCCGACCGGTCCGGCACGAGCTACGCCCGCGAGGGCGGCTTCCTGCAC
GACGCGGCCGCCTTCGACGCGGCCTTCTTCGAGATCAGCCCGCGGGAGGCCACGGCCACG
GACCCGCAGCAGCGGCTGCTGCTGGAGGCCGCCTGGGAGACGTTCGAGCGCGCGGACCTG
GACCCGCACAGCTTGCGGGGCAGCAGGACCGGCGTCTTCGCGGGCGTCATGTACAGCGAC
TACGTAGCCCGGCTCATGGACCGGCTGCCGCCGGGGTTCGAAGGCTTCCTGGGCAATGGT
GGTGCGGCGAGTGTGGCGTCGGGTCGGGTGGCGTACACCTTCGGTCTCGAAGGCCCCGCG
GTCACCGTCGACACCGCCTGCTCCTCGTCGCTGGTGAGCATGCACCTGGCTGCGCAGGCG
TTGCGCAACGAGGAGTGTGATCTTGCGCTTGCCGGTGGTGTGACGGTGATGGCCACTCCG
GGTGTGTTCGTGGAGTTCTCGCGGCAGCGTGGGTTGGCGCCTGATGGGCGGTGCAAGCCG
TTCGCGGAGGCTGCCGACGGTACGGGCTGGGGCGAGGGTGTCGGTTTCGTGCTGCTGGAG
CGGCTGTCGGACGCGGAGCGCAACGGGCACGAGATTCTGGCGGTGCTGCGGGGTTCGGCC
GTCAACCAGGACGGCGCTTCCAACGGTCTGACCGCGCCCAACGGCCCTTCCCAGCAGCGG
GTCATCGAACAGGCGTTGGCCAGTGCGCGGTTGAGTGCGGGTCAGGTCGATGCGGTCGAG
GCGCACGGTACGGGTACGACGCTGGGCGACCCGATCGAGGCACAGGCGCTGCTGGCCACC
TATGGTCAGGCGCATTCTGCGGAGCGGCCGTTGTGGCTGGGTGCGGTGAAGTCGAACATC
GGTCACACCCAGGCCGCGGCGGGTGTCGCGGGTGTGATCAAGATGGTCGAGGCCATGCGC
CACGGCGTCCTGCCCCGCACCCTCCACGTCGACGAACCCTCCACCCACGTCGACTGGAAC
ACCGGCCACGTCGCCCTCCTGACCGAAGCGCAACAGTGGCCCGAGACGGGTGAGCCGCGA
CGCGCGGCGGTGTCGTCGTTCGGGATCAGCGGCACCAACGCGCACGTCATCCTGGAGGCC
GCCCCGGAGCCCGGTAAGCCGGTCGAGGAGCGGGTCGACAAGTCGATGCCGGTGCCGGTG
GTGGTCTCGGCGCGTTCGTCGGCGGCGCTGGCGGAGGCCGCGGGTCGGCTGGCGGCGTAC
GTCGAGCACCACCCGGACGTCGAGATCGGCGCGCTGGCGGCGCGACTGTGGTCCGGGCGC
GCGAAGCTGGAGCACCGCGCGGGCGTCGTCACCGCCGACCCCACCGAACTCCACGAAGCC
CTCACCGCACTCGCCGCCGGCACCACGCACCCGGCGCTGGTCACCGGCCCCGGGTCCGCC
GAGACCGGTGGGCGGCTTGCGGTGATGTTCTCCGGACAGGGCAGCCAACGCCCCGGCATG
GGCCGCGACCTGTACGAGACCTTCCCCGCCTACGCCGAAGCCCTGGACGAGGTCTGCGCC
GCGCTGGACCAGCACCTCGACACCGAGGTCCCACTACGGGACGTGATGTTCGCCGAACCC
GGCAGCGAGCACGCCGCGCTGCTGGAGACGACGCTCTACACCCAGCCCGCCCTCTTCGCC
CACCACGTGGCCGGCTACCGCCTCCTCCAAAAGGTAGGCGTTCAGCCCGCGGCGCTCATC
GGTCACTCCATCGGCGAACTCTCGGCCGCCCACCTCACCGGCACCCTCCCCCTCGCCGTG
GCCGCCGACATGGTCGCCACCCGCGCCAAGCTGCTCCACACCCTCCCCGACGGCACCGGC
ATGCTCGCCGTCAACACCGACGCCGACACCCTCACCCCGTACCTCAAGCGCCACGAAGAC
GTGGCCGTCGCCGCGCACAACTCCGCCACGTCCCTCGCCGTCGCCGGCCCGCACCAGCCG
CTCCGGGAACTCGCCGCGGAGCTGACCGAGGCGGGGATCCGCACCAAGGCTTTGAAGGTC
GCGCACGCCTTCCACACCGCGCACACCGAGCCGATCCTCGACACCTTCACCGGCCACCTG
ACGGACCTCTTCAACCGCCACACCCTCGGCGACGCCGACATCCCCGTCATCTCCAACGTC
ACCGGCCTACCCGCCACCAGCGGGCAACACCACGACCCCGAATACTGGGCCCAGCACATC
CGCCAACCCGTCCACTTCCACCAAGGCATCACCCACCTCACCACCGACGACAGCATCAGC
CTCTTCACCGAGCTGGCCCCGCATCCCACCCTCGCGCCCCAGCTCCCGTCCGGTACGAAG
CGGACCCCCCGTCTGCCGACGGAGACCCTCACCCACCTCGCCACCCTGGTCGGCCTCCAC
GGCAACCACCACCCCGTCGACCTCGCCGCCCACCTCCCCGAGACCGCGGCCAAGGTCCCC
GCGCTCCCCACCTACCCCTTCCAGCACCGCCCCTACTGGCTGCGCGCCGACCCCGCCAAG
GGGACCGATGCCCGCCCCGGCGACGCCGAATTGTGGGACGCACTGGAGCGCGAGGACCTG
GACGGCGTGCTGTCCGCGATGGGTGTGCGGGACGCCGATGTCACGGCGTGGAAGGCCGTC
CTGCCCTCGCTCGTCACCTGGCGCCGCCAGCGCGGCTGGGGCCACCGCCTCGGCTGGGAG
GCCCTGGACGACGGCACGCCGCCGCTGCTCGACGGCGCCTGGGTCGTCCTGCTCCCCGAG
GACGCCGCGGAGCACCCAGCCGTACGGACCGCGTTGACCGCGCTGGACGAGGGCGGAGCC
GGAGTCGAGGTCGTCACCGTCGAGCGGCAGATGGCCCGTACGACGTTCGCCGGCCGGTTG
CGTGCCGCGCTGAGCGCCTGCGGGGCCCGGCTCGCCGGAGTGCTGTCCCTGCTGGCGTTC
GCCGACCCGGCCCGGCCGGGCCCCGACGGGCTGGAGCTGTCCGCCACGCTGCTGCACGCG
CTCGACGACGCGGCCGCGCAGGTACCCGTGTGGTTCCTCACCGCGGGCGGTACCACGGCG
GGCGGCGAGGACCCGCTCGCCGACCCCGCCCAGGCCCGGATCCGGGGGCTGGCGCAGTCG
CTCGCCGTCGAACACCCCGAGCGCTGGGGCGGCTTGGCCGACCTGCCCGCCGGCGGTGCC
GGCGGCCGGGACGTACGCGACCGCCTCCGGGCGGCGCTCGCCGGGCGGGCCGACCGCTCG
GGCGCCCGCGAGGACCAGGTCGCCGTCCGGGCCGGGGCGCTGTTCGCCCGCCGGATGCGC
CCCGCGGACCTCGCCGCCGCCACCGAACCGTGGCTGCGCGCCACGGACGGCACCGTGCTG
GTGACCGGGGCGGGCGGCGCGCTCGCGGAGGAGATCGCCGTGCAGCTCGTACGCGAAGGC
GTACGGCACCTGCTGCTGGCCACCGGGCCCGGCGCGTACGGGGAAGCCGCAGCGCTGGTC
GCGCAGTTGCGGGAGGCGGGCGCGGAGCCCGTGGTGGCCGCCATCGACCTCGCCGACCGC
GACGCGGTCGCCGCACTCGTCCGCTCCGTCGCGCCCGAGCACCCGCTGACCGCCGTCGTG
CACGTCGCCGCCCAACTCGACGACGCCGTCGTCGGTGCGGTGGACGCCGACGACGTCGGC
CGGCTGCTCGACCCGGCCGCGGCGGCCTTGGCCAACCTCTGCGAGCTGACCCTCGACCGC
GGGCTGGAGTCGTTCGTCCACTGCACCTCCGCGGTCGGCGCCCTCGGCGCGGCCGGCTTC
GGCGCCCAGGGGGCGGTCCACGCCCACCTGGAGGCGCTGGCGCAGACGTATCGCGAACGC
GGCCTGCCCGTCACCTCCGTGGTCTGCGGCCCGTGGCAGGACCCGGAGGCGGCGGACACC
GCGGCCGGAAAGCACCTGCGCTACCAGGGCATCCGCCCCATGGCGCCGCGACTCGCGGCA
CGGCTGCTGGTACGCGCCGTCGCCGGCCGCCCGGCCACGCCCGTGCTGGTCGACGTCGAC
TGGGACCGCTACGTCAGGCAGTCCGAACAGGGCGCCGCCGGCTCCCTGCTGCGCGCGATC
CCCGAAGCCGGGGCCGGCGCGGGGGACGGCGGCGCCTGGGAGCCCGAGACCGACGGAGCC
GGGCCCCTCGGCGAGGCCGCGGCGCGGCTGCGCCAACGGCTCGACACCGCCGCCGGCGCC
GAGCGGGCCGAGCTGCTGCTGGAACTGCTGCGGGACGCCGCCGCCCAGGTCCTGGGACAC
GCGGACACCGGGGAGATCGCCGCCGACGCCCAGTTCACCGAGCTGGGGTTCTCCTCCTTC
ACCGCCCTCGAACTGTGCAACCGGGTCGCGGCCGTGTCGGGGCTGGAGATCCCGCCGATG
GCCATCTTCGACAACCCCACGCCGCAGGCGCTGGCGGGCTATCTGATGACCACCTTCGAG
GGGGAGACCTCCCTCGCCACAGCGGCCGGGGCCGCGGCCCGGTGA
[12] KS34..411
[12] AT570..861
[12] malonyl-CoA762..766
[12] kr1197..1374
[12] ACP1486..1556
[12] KS100..1233
[12] AT1708..2583
[12] malonyl-CoA2284..2298
[12] kr3589..4122
[12] ACP4456..4668

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-695]  1.40000000000001e-61 G3DSA:3.40.366.10 [762-855]  1.40000000000001e-61 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1489-1555]  2.7e-11 PF00550
PF00550   PP-binding
 [1485-1557]  6.40000000000001e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1478-1573]  2.19999900980708e-18 SSF47336
SSF47336   ACP_like
 [1486-1556]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1197-1374]  6.19999999999994e-37 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-285]  4.40000000000003e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  3.09999999999998e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [570-861]  4.5e-56 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-25]  2.1e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [565-877]  7.40000780398343e-55 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [697-761]  2.89999717862184e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  2.99999999999998e-87 G3DSA:3.40.47.10 [297-463]  4.49999999999996e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-463]  8.00002659346736e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1195-1395]  5.69999999999998e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [569-883]  3.99998544139406e-84 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1487-1559]  3.69999438558106e-22 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit