close all open/close all

CDS information : Tetrn_00120


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction30,591 / 30,166 / - [in whole cluster]
30,591 / 30,166 / - [in contig]
Locationcomplement(30166..30591) [in whole cluster]
complement(30166..30591) [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative epoxide hydrolase/cyclase
Product (GenBank)probable epoxide hydrolase
Gene
Gene (GenBank)tmnB
EC number
Keyword
  • furan ring
Note
  • Belongs to polyether epoxide hydrolase(PEH)-A group.
Note (GenBank)
  • homologue of MonBII and MonBI proteins of polyether monensin biosynthetic cluster and NanI protein of polyether nanchangmycin biosynthetic cluster
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q846W8
NITE
Monen_00230
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16632258] Evidence for the role of the monB genes in polyether ring formation during monensin biosynthesis. (Chem Biol. , 2006)
ACC
B6ZK72
NITE
Lasal_00210
PmId
[18710235] Epoxide hydrolase Lsd19 for polyether formation in the biosynthesis of lasalocid A: direct experimental evidence on polyene-polyepoxide hypothesis in polyether biosynthesis. (J Am Chem Soc. , 2008)
[21375229] Enzymatic epoxide-opening cascades catalyzed by a pair of epoxide hydrolases in the ionophore polyether biosynthesis. (Org Lett. , 2011)
[22388816] Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis. (Nature. , 2012)

close this sectionSequence

selected fasta
>putative epoxide hydrolase/cyclase [probable epoxide hydrolase]
MLDEDARKRVALEYCRRIGAGDVDGVLALFADPLHVEDPVGDKTFTARAEYRAHIARLVS
YGVHEVPGTPVAGLDREHVALPITVELRPEGVPQGKIVRISLIAVMRIGGDGLIRHMRVI
SGRTDMSLHDAAEAADAARFM
selected fasta
>putative epoxide hydrolase/cyclase [probable epoxide hydrolase]
ATGCTGGACGAGGACGCGCGCAAACGAGTCGCTCTGGAGTACTGCCGCCGGATCGGCGCG
GGCGACGTCGACGGCGTCCTCGCCCTCTTCGCCGACCCGCTGCACGTCGAGGACCCGGTC
GGCGACAAGACCTTCACCGCACGCGCCGAGTACCGCGCGCACATCGCCCGGCTGGTGTCG
TACGGCGTGCACGAGGTCCCCGGCACCCCGGTCGCCGGCCTGGACCGCGAGCACGTCGCC
CTGCCCATCACCGTCGAACTGCGCCCGGAGGGCGTGCCGCAGGGCAAGATCGTGCGGATC
TCCCTGATCGCGGTCATGCGGATCGGCGGCGACGGCCTCATCCGCCACATGCGGGTCATC
AGCGGCCGGACGGACATGTCGCTGCACGACGCGGCCGAGGCCGCGGACGCCGCACGGTTC
ATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [13-116]  2.3e-08 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit