close all open/close all

CDS information : Tetrn_00130


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction30,800 / 31,702 / + [in whole cluster]
30,800 / 31,702 / + [in contig]
Location30800..31702 [in whole cluster]
30800..31702 [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)putative methyltransferase
Gene
Gene (GenBank)tmn12
EC number2.1.1.-
Keyword
  • C-25
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q54095
PmId
[1840640] Cloning and sequence analysis of genes involved in erythromycin biosynthesis in Saccharopolyspora erythraea: sequence similarities between EryG and a family of S-adenosylmethionine-dependent methyltransferases. (Mol Gen Genet. , 1991)
[2185226] Mutation and cloning of eryG, the structural gene for erythromycin O-methyltransferase from Saccharopolyspora erythraea, and expression of eryG in Escherichia coli. (J Bacteriol. , 1990)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative O-methyltransferase [putative methyltransferase]
MKSSLWQDLRMLGNLFLVRTTSDPEKKTARLYEMYPPDRLVVEDTNYYNLGYWPGATKLD
EAAQALADELADTAGFKPDDTVLDVGFGYGDQDFHWIDKYGPSKIIGINITKVHIRIATD
RARERGLLDRIDFREGSATAIPLPDNSVDKVVALESAFHFDTRADFFAEAYRVLRPGGVL
VTADIIPMEGGKPKADIRSHAIKWIRVMIDDANWYPRKKYGEIMESKGFEGVEVRTIRDE
VYEPWREYHVRRLQDPTFKKRSSKLFYKMVAIAHRDQDLLTEELKSLDYVVASARKPVEP
selected fasta
>putative O-methyltransferase [putative methyltransferase]
GTGAAGTCGTCACTGTGGCAGGACTTGCGGATGCTGGGAAACCTCTTCCTGGTCCGTACG
ACGTCCGACCCGGAGAAGAAGACAGCGCGGCTGTACGAGATGTACCCGCCGGACCGGCTG
GTCGTCGAGGACACCAACTACTACAACCTCGGCTACTGGCCGGGGGCCACGAAGCTCGAC
GAGGCGGCGCAGGCCCTCGCCGACGAGCTGGCCGACACGGCCGGGTTCAAGCCGGACGAC
ACCGTTCTGGATGTCGGCTTCGGCTACGGCGACCAGGACTTCCACTGGATCGACAAGTAC
GGGCCGAGCAAGATCATCGGCATCAACATCACCAAGGTGCACATCCGGATCGCCACGGAC
CGCGCCCGGGAGCGCGGGCTGCTGGACCGGATCGACTTCCGCGAGGGCTCGGCGACGGCG
ATCCCGCTGCCGGACAACAGCGTCGACAAGGTGGTGGCGCTGGAGTCGGCCTTCCACTTC
GACACCCGCGCGGACTTCTTCGCCGAGGCGTACCGCGTGCTGCGCCCGGGCGGCGTGCTC
GTGACCGCCGACATCATCCCGATGGAGGGCGGCAAGCCCAAGGCGGACATCCGTTCGCAC
GCCATCAAGTGGATCCGCGTCATGATCGACGACGCCAACTGGTACCCGCGCAAGAAGTAC
GGCGAGATCATGGAGTCCAAGGGCTTCGAGGGCGTCGAGGTGCGGACGATCCGCGACGAG
GTCTACGAGCCGTGGCGTGAGTACCACGTGCGCCGCCTCCAGGACCCGACGTTCAAGAAG
CGGTCCAGCAAGCTCTTCTACAAGATGGTCGCCATCGCCCACCGCGACCAGGACCTGCTC
ACCGAAGAGCTGAAGTCCCTCGACTACGTGGTGGCCTCGGCCCGCAAGCCGGTCGAGCCG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [83-181]  3.3e-18 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit