close all open/close all

CDS information : Tetrn_00140


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction31,918 / 36,894 / + [in whole cluster]
31,918 / 36,894 / + [in contig]
Location31918..36894 [in whole cluster]
31918..36894 [in contig]
TypeCDS
Length4,977 bp (1,658 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)tmnAII
EC number
Keyword
Note
Note (GenBank)
  • module 3 (KS, AT-A, KR, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

3 malonyl-CoA
not conserved HAFHS
KS36..411
AT570..887
KR1204..1383
ACP1491..1561

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MASSNEEKLRDYLKAVTADLRQTRQRLQSLEERDHEPIAVVGMACRYPGGAVSPDALWEL
VSAGGDAIGEFPGDRGWDLEAVFDADPDRAGTSYARRGGFLYDLPEFDAGLFGVSPREAA
AMDPQQRLLLELAWEALERAGIAADGLRGSATGVFAGTSAADYGPRLHEASGGAEGYMLT
GTTPSVASGRIAYTLGLEGPALTVDTACSSSLVAVHLATRALRAQECTMALAGGATVMST
PGMFVEFSRQRGLASDGRCKSFSEDADGTGWAEGAGMLVLERLSDARAAGHPVLAVIRGS
AVNQDGASNGLTAPNGPAQRRVIEQALADARLTARQVDAVEAHGTGTSLGDPIEAQALLA
TYGREHTAEQPLWLGSVKSNIGHTQTAAGVAGIIKMVQAMRYGRLPRTLHAGTPSRHVDW
DAGGVALLAEEVAWPESDRPRRAAVSAFGISGTNAHVVLEQAPPTADTDRDEPSGGAGAR
TALWTLSARTGEALRARAAELAEAVRTDPAPAAGDVGFSLATTRAAFDERAVVLGGDADE
LAGGLAALAADRGSPRVVRGSAVSGAARPVFVFSGQGAQWPGMAVGLWDSEPVFAASMER
CAAGLAPHTGYALREKLTAPADDPAWERDDVVQPLLWAVMVSLAELWRHHGVAPAAVVGH
SQGEFAAAVVAGALSLEDGARLVAVRSRVVHALSGHGSMASVSLPVAEVEKRLAETGGDV
GIAAVNGPSATVVAGVDADVRAFMRDCEERGVRTRTVPIAYASHSPLVEPVREEMLRELA
AITPRAGEVPFYSTVTGEPMPTESLDAAYWYRNLRSPVLFAQTAERLMDAGHTVFLEMGA
HPVLVPAIEQVLDATETEGRALGTLRRGEDGEPRFKQALAEAYAAGVVPDWQVLFPGART
VPLPTYPFQRRRYWLADRDDRTPQNAAGGGTDDAFWALVERADTGALRRELPEVGEDALR
EVVPALHRWRTRSRTDAALNSRRYEIGWRPSAERRTPGPGGHWLLVTRDGADGRPAAWAG
AADTALRARGARVTVVALDERAADDRADVTRRVSAALAGEAVDGVLSLLALDERAHPGHP
ALPSGVAGLLGLVQALVELDVAAPVWSLTCAAVSALDDEVPAYPLQAQTWGLGRVVALEQ
PQLWGGLVDLPERPGDEDWQRLCAVLAGAAGDEDQVAVRPGGLRVRRLLPAPAPAGGPAW
QPSGTVVVTGGSGSLAPHLARWLADGGAEHIVLASRRGPDAPGHAALAEELGGRGVRVTA
LSCDLTDRDSVRSLLERSAEPGRPVRAVVHAATATHLEPLAGASAAGVADVLAAKALGAV
HLAELLAGEDAELVFFSSIAAVWGSGEHGAYAAANAFLDAYAEQLRGQGRKVTSVAFGAW
RSEQLPEELDEAQLTRQGLPLLDPEVALTGLGRELAAGGGRPVTLVDVDWETFAPVFASA
RPRPLLDEVPAARGALRRSAADGAGTAAAGGAGELLKRLAQLPEAARGREVLDVVTAEVA
AVLGHGPADRPAPGQTFKELGLDSLTAVALRNRLRAATGLPLPVTLVFDHPSPQALARFL
TGQLGAAGEQAPPGSVHEELDRLAAALDAAPVEGAERVAVQDRLRALAAALADHGTAADG
MPADDEAGLDEASTDDLLKIIDDEFGPAEPGPTASTIG
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGGCCAGTAGCAACGAGGAAAAGCTCCGCGACTACCTGAAGGCGGTCACCGCCGATCTG
CGCCAGACCCGGCAGCGGCTCCAGTCGCTGGAGGAGCGCGACCACGAGCCGATCGCGGTG
GTCGGGATGGCCTGCCGCTACCCCGGCGGCGCGGTGTCGCCCGACGCGCTGTGGGAGCTG
GTGTCGGCGGGCGGGGACGCCATCGGCGAGTTCCCCGGCGACCGGGGCTGGGACCTGGAG
GCGGTCTTCGACGCGGACCCGGACCGGGCGGGCACGAGCTACGCCCGCCGCGGCGGCTTC
CTCTACGACCTGCCGGAGTTCGACGCCGGGCTGTTCGGGGTCTCCCCGCGGGAGGCCGCG
GCGATGGACCCGCAGCAGCGGCTGCTGCTGGAGCTGGCCTGGGAGGCGCTGGAGCGGGCG
GGCATCGCGGCCGACGGGCTGCGCGGCTCCGCCACCGGCGTGTTCGCCGGCACCTCGGCG
GCCGACTACGGGCCGCGGCTGCACGAGGCGAGCGGCGGCGCCGAGGGCTACATGCTGACC
GGGACCACGCCGAGCGTCGCCTCCGGGCGGATCGCGTACACGCTGGGCCTGGAGGGCCCG
GCGCTGACGGTGGACACGGCGTGCTCGTCCTCGCTGGTCGCGGTGCACCTGGCCACGCGC
GCGCTGCGCGCGCAGGAGTGCACGATGGCGCTGGCCGGCGGGGCGACGGTGATGTCGACG
CCGGGCATGTTCGTGGAGTTCTCGCGGCAGCGCGGGCTGGCGTCCGACGGGCGCTGCAAG
TCGTTCTCCGAGGACGCCGACGGCACCGGCTGGGCCGAGGGCGCGGGCATGCTCGTGCTG
GAGCGGCTCTCCGACGCCCGGGCCGCCGGGCACCCGGTGCTCGCGGTGATCCGCGGCAGC
GCCGTCAACCAGGACGGCGCCTCCAACGGACTCACCGCCCCCAACGGCCCCGCGCAGCGG
CGCGTCATCGAGCAGGCACTCGCCGACGCCCGGCTCACCGCGCGGCAGGTCGACGCCGTC
GAGGCGCACGGCACGGGCACGTCGCTGGGCGACCCGATCGAGGCGCAGGCGCTGCTGGCG
ACGTACGGCCGTGAGCACACCGCGGAACAGCCGCTGTGGCTGGGCTCGGTGAAGTCCAAC
ATCGGCCACACCCAGACCGCCGCCGGGGTGGCCGGGATCATCAAGATGGTGCAGGCCATG
CGGTACGGCCGGCTGCCGCGGACGCTGCACGCCGGGACGCCGTCGCGGCACGTCGACTGG
GACGCGGGCGGCGTCGCGCTGCTCGCCGAGGAGGTCGCCTGGCCCGAGTCGGACCGGCCG
CGGCGGGCCGCGGTCTCCGCGTTCGGCATCAGCGGCACCAACGCGCACGTCGTCCTGGAG
CAGGCGCCGCCCACCGCGGACACTGACAGGGACGAGCCCTCCGGCGGGGCCGGGGCGCGC
ACCGCGCTGTGGACGCTGTCCGCCCGTACCGGCGAGGCGCTGCGCGCCCGGGCCGCGGAG
CTGGCCGAGGCGGTACGCACCGACCCGGCACCCGCCGCCGGGGACGTCGGCTTCTCGCTG
GCGACGACGCGTGCGGCCTTCGACGAGCGGGCCGTCGTGCTGGGCGGCGACGCCGACGAG
TTGGCCGGGGGCCTGGCGGCGCTGGCGGCGGACCGCGGCTCCCCGCGGGTCGTACGCGGC
AGCGCGGTGTCCGGCGCGGCCCGCCCGGTCTTCGTCTTCTCCGGGCAGGGCGCGCAGTGG
CCGGGGATGGCCGTCGGACTGTGGGACTCCGAGCCGGTGTTCGCCGCGTCGATGGAGCGC
TGCGCCGCGGGCCTCGCCCCGCACACCGGCTACGCGCTGCGCGAGAAGCTGACCGCCCCC
GCGGACGACCCGGCCTGGGAGCGCGACGACGTGGTGCAGCCGCTGCTGTGGGCGGTGATG
GTCTCGCTGGCCGAGCTGTGGCGCCACCACGGCGTGGCGCCGGCCGCGGTCGTGGGCCAT
TCGCAGGGCGAGTTCGCGGCGGCCGTGGTCGCCGGGGCACTGTCGCTGGAGGACGGCGCC
CGGCTGGTGGCCGTACGCAGCAGGGTGGTGCACGCGCTGTCCGGGCACGGCTCGATGGCC
TCGGTGTCGCTGCCCGTCGCGGAGGTGGAGAAGCGGCTCGCGGAGACCGGTGGCGACGTC
GGCATCGCGGCCGTCAACGGGCCGTCGGCCACGGTCGTCGCGGGTGTCGACGCGGACGTG
CGGGCGTTCATGCGCGACTGCGAGGAGCGGGGCGTGCGGACGCGGACCGTGCCCATCGCG
TACGCCTCGCACTCGCCGCTCGTCGAGCCGGTGCGCGAGGAGATGCTGCGCGAGCTGGCG
GCCATCACGCCGCGGGCCGGGGAGGTGCCGTTCTACTCCACCGTCACCGGCGAGCCGATG
CCCACCGAGTCGCTGGACGCCGCGTACTGGTACCGCAACCTGCGCTCCCCCGTGCTCTTC
GCGCAGACCGCGGAGCGGCTGATGGACGCGGGCCACACCGTGTTCCTGGAGATGGGCGCG
CACCCGGTGCTCGTGCCCGCGATCGAGCAGGTCCTCGACGCGACGGAGACCGAGGGGCGG
GCGCTGGGCACGCTGCGCCGCGGCGAGGACGGCGAGCCGCGCTTCAAGCAGGCGCTGGCG
GAGGCGTACGCCGCCGGCGTGGTGCCCGACTGGCAGGTGCTCTTCCCCGGCGCCCGGACG
GTGCCGCTGCCCACCTACCCCTTCCAGCGCCGGCGTTACTGGCTCGCCGACCGCGACGAC
CGTACGCCGCAGAACGCCGCCGGCGGCGGGACGGACGACGCGTTCTGGGCGCTGGTCGAG
CGGGCCGACACCGGGGCGCTGCGCCGGGAGCTGCCCGAGGTCGGCGAGGACGCGCTGCGC
GAGGTGGTGCCGGCGCTGCATCGCTGGCGCACCAGGAGCCGTACGGACGCGGCGCTCAAC
AGCCGTCGCTACGAGATCGGTTGGCGCCCGTCCGCGGAGCGGCGGACGCCGGGGCCCGGC
GGGCACTGGCTGCTGGTGACCCGTGACGGCGCCGACGGGCGGCCGGCCGCCTGGGCCGGC
GCGGCGGACACCGCGCTCCGTGCCCGCGGCGCCCGGGTGACCGTGGTCGCGCTGGACGAG
CGGGCCGCCGACGACCGCGCGGACGTCACGCGGCGCGTGTCGGCGGCGCTGGCCGGCGAG
GCGGTCGACGGGGTGCTGTCGCTGCTGGCGCTGGACGAGCGCGCCCACCCCGGGCACCCG
GCGCTGCCGTCCGGTGTCGCGGGGCTGCTGGGGCTCGTGCAGGCGCTGGTGGAGCTGGAT
GTGGCCGCGCCCGTGTGGTCGCTGACGTGCGCCGCGGTGAGCGCCCTCGACGACGAGGTA
CCGGCGTACCCGCTCCAGGCGCAGACCTGGGGTCTCGGCCGGGTGGTGGCGCTGGAGCAG
CCGCAGTTGTGGGGCGGCCTGGTCGACCTCCCGGAGCGGCCGGGCGACGAGGACTGGCAG
CGGTTGTGCGCGGTTCTCGCGGGCGCTGCGGGCGACGAGGACCAGGTGGCGGTCCGGCCC
GGCGGGCTGCGCGTGCGGCGGCTGCTGCCCGCGCCGGCGCCCGCGGGCGGACCCGCGTGG
CAGCCGAGCGGCACGGTCGTGGTCACCGGGGGCTCCGGCTCACTGGCGCCGCACCTGGCG
CGCTGGCTGGCCGACGGCGGCGCGGAGCACATCGTGCTGGCCAGCCGGCGCGGCCCCGAC
GCGCCCGGCCACGCCGCGCTGGCCGAGGAGTTGGGCGGGCGGGGCGTCCGGGTCACGGCG
CTGTCCTGCGACCTGACCGACCGCGACTCCGTACGGTCCCTGCTGGAGCGGTCCGCGGAG
CCGGGCAGGCCGGTGCGGGCGGTGGTGCACGCCGCGACCGCGACCCACCTGGAGCCGCTG
GCCGGCGCCTCCGCCGCCGGGGTGGCGGACGTCCTGGCGGCGAAGGCGCTCGGGGCGGTG
CACCTCGCCGAGCTGCTGGCCGGGGAGGACGCGGAGTTGGTGTTCTTCTCCTCCATCGCG
GCCGTCTGGGGCAGCGGTGAGCACGGCGCGTACGCGGCGGCGAACGCCTTCCTCGACGCG
TACGCGGAGCAGCTTCGCGGCCAGGGCCGGAAGGTGACGTCTGTCGCCTTCGGCGCGTGG
CGCAGCGAGCAGTTGCCCGAGGAGCTGGACGAGGCCCAGTTGACGCGGCAGGGCCTGCCG
CTGCTGGACCCGGAGGTCGCGCTCACCGGCCTCGGCCGGGAGCTGGCCGCGGGCGGTGGC
CGGCCCGTCACGCTGGTCGACGTCGACTGGGAGACGTTCGCCCCGGTCTTCGCCTCGGCC
CGGCCCCGGCCGCTGCTGGACGAGGTCCCGGCCGCCCGCGGTGCGCTGCGGCGCTCCGCG
GCGGACGGCGCCGGCACGGCTGCCGCGGGCGGCGCCGGGGAGCTGCTGAAGCGGCTGGCG
CAGCTGCCCGAGGCGGCCCGCGGACGCGAGGTGCTGGACGTCGTGACCGCCGAGGTGGCC
GCGGTGCTGGGCCACGGCCCGGCGGACCGGCCCGCTCCGGGGCAGACTTTCAAGGAACTG
GGTCTGGACTCGCTGACCGCGGTGGCGCTGCGCAACCGGCTGCGCGCCGCGACGGGACTC
CCGCTGCCGGTGACGCTCGTGTTCGACCACCCCAGCCCGCAGGCTCTCGCCCGCTTCCTG
ACCGGGCAGTTGGGCGCGGCGGGCGAGCAGGCGCCGCCCGGCTCCGTACACGAGGAGCTG
GACCGGCTGGCCGCGGCCCTGGACGCCGCGCCCGTCGAGGGTGCGGAACGCGTCGCCGTG
CAGGACCGGTTGCGGGCGCTGGCGGCCGCGCTGGCCGACCACGGGACCGCGGCGGACGGC
ATGCCCGCGGACGACGAGGCGGGTCTCGACGAGGCCAGCACCGACGACCTGCTGAAGATC
ATCGACGACGAGTTCGGCCCGGCGGAGCCGGGTCCGACGGCATCGACAATCGGCTGA
[3] KS36..411
[3] AT570..887
[3] malonyl-CoA not conserved HAFHS761..765
[3] KR1204..1383
[3] ACP1491..1561
[3] KS106..1233
[3] AT1708..2661
[3] malonyl-CoA not conserved HAFHS2281..2295
[3] KR3610..4149
[3] ACP4471..4683

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [564-693]  2.70000000000002e-74 G3DSA:3.40.366.10 [761-877]  2.70000000000002e-74 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1519-1534]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1491-1561]  PS50075
PS50075   ACP_DOMAIN
 [1490-1565]  1.8e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1494-1560]  1e-12 PF00550
PF00550   PP-binding
 [1483-1578]  3.39999972437717e-22 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1204-1382]  8.30000000000004e-51 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-286]  7.20000000000003e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-411]  2.50000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [570-887]  5.00000000000001e-98 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-28]  3.1e-13 PF08990
PF08990   Docking
 [3-36]  3.79999862644791e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [568-857]  2.1000026783403e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-760]  6.59999852526375e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-298]  6.70000000000006e-89 G3DSA:3.40.47.10 [299-464]  6.29999999999998e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-464]  4.10001399699315e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1204-1384]  4.30000000000003e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-869]  1.3000049540733e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1492-1564]  1.79999754022375e-35 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-464]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1204-1383]  3.29999077503323e-37 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit