close all open/close all

CDS information : Tetrn_00150


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction36,935 / 47,161 / + [in whole cluster]
36,935 / 47,161 / + [in contig]
Location36935..47161 [in whole cluster]
36935..47161 [in contig]
TypeCDS
Length10,227 bp (3,408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)tmnAIII
EC number
Keyword
Note
Note (GenBank)
  • module 4 (KS, AT-A, DH, KR, and ACP); module 5 (KS, AT-A, KR, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

4 malonyl-CoA
5 malonyl-CoA
KS34..410
AT567..896
DH940..1115
KR1418..1598
ACP1704..1774
KS1799..2176
AT2335..2641
KR2951..3134
ACP3242..3312

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MAEEDKLRDYLKRLTVDLRRTTRRLREVEEQRREPVAVVGMACRLPGGVRSPEELWELLR
DGRDAISAMPANRDWHLDDHFDPDLGRPGTSYVREGGFLDDVAGFDAAFFGISPREALAM
DPQQRLLLELAWESVERAGIDAHALRGSRTGVFVGSNPTEYGGLLGDAAAQVGGHLLTGT
VLSVLSGRLAYTLGLEGPAVSVDTACSTSLTAVHLAVQALRRGECTMALAGGATVFSTVG
PFTEMSRQRVLAADGRCKAFGAGADGMGMSEGAGVVLLEPLSAARRNGHRVLAVIRGSAV
NSDGSSNGLTAPSGQAQEKVIRAALADAGLGAADVDAIEAHGTGTELGDPIEAQALLEVY
GRGRAAAKAPLYLGSVKSNIGHTQAAAGVAGLMKLVLALEHGQLPRTLHADTPSPHVDWD
PATLALLDEALPWRGEDRTRRAAVSAFGISGTNAHVIVEQPPADEQEPAAPEASGNPVRP
WLVSAATADGLRAQAARLADHVRARPELTADAVGHALATSRATLGHRAVLLGADRGELLG
RLDALGRGDAATGLVTGVQQTGRLALMFSGQGSQRAGMGRELYEAFPVFAEALDEVCAAL
DGHLDVPVREVMFAAAGTERAALLEHTLYTQPALFAMHTALARLLASWGVRPDHLIGHSV
GELSAAHVAGVFPLGVAADMVATRAKLMHSLPEGTGMLAVRSGPEPLAGQLERHAGVEVA
AYNSPAATALAGPLDVLDELARELTGAGVRARRLHVAHAFHSAHTEPVLDAFAHHLADLF
DRHAPGEAEVPVISNVTGLPATSEQHRDPAYWAEHIRRPVRFHQGVADLAARGTTTYLEL
GPDAGLSTLAQAVLDEADPAQPGGEPAVVTSVLRRAHPEVPALLTAVARLHVHGTDVDWR
ALHADGRPAELPTYAFQRRPYWLRQARPAADRPGVRVTRHPLLGAVLETADAERPGAVFT
GRISARTPGWLPDHVLGTTVVLPGTGTVEVALCAARHVGCARVEELTLRHPVVLPAEGAL
QLQVAVAAPDAAGRRSLSLYARPEPDADEDSPELAADAAWTLHATGVLAPGATAAADAWD
GAAWPPAGEPAAVVDDLYDRLHERGMRFGPAFRSLRTVWRTDEHLYADLALPEAHHEDLD
EYGIHPALLDAALHTVALLDESGTELRLPFAWSGVRLLARPALRSLRARVTPTGPETVAL
DLADAAGTPVLRVDEVAPRPVPADSLGAVSADPLYGVQWQRVDAPEAADGAELRETDLDA
FAGVLDAAGAGSEGSGVYVVRCPDADGGDADGTAERARTTVARVLTAVQRWLSDDRFADS
RLAVVTRGAVGADADGDVPALESAPVWGLLRSAQSEHPDRIVLVDDDPGQGSSLDAADAV
RAALAAGEPQVAIRGGGLLAPRLTRIEPDRPAALDPEGTVLVTGASGTLGGQVAAHLVAA
HGVRRLLLVSRRGQEAPGAGELRAELAGLGAEVAFAACDVADPDALAGALDAIPAEHPLT
AVVHAAGVLDDATVGELTPAQLDAVLRPKTDGAWHLHRLTADRPRVAFVLFSSFASVVGT
PGQANYAAANSFLDALAQHRRARGLPAVSLAWGLWEQGGMGESLDRAARARIARAGVRAM
SASRALALLDTALRSPVALAAPVVLDRPALRAQSRAGTLPAVLRTQAPAPAAPAGGSADP
AAPAAADPLAGLAALGRAEQDRTLLALVRRTAVLALGLPEGESVSPGQTFRDLGFDSLTA
VEMRNRLSAATGRRLPATAVFDHPTPQALADHLRTELLGSDGAAAPAAPKAAPRAADDDP
IAVVAMSCRYPGGVDSPAGLWDLLSRGAEGTSTFPENRGWDIDAIFDPSGERPGTTYTRA
GSFLHEADRFDAEFFGISPREAASMDPQQRLLLELCWEAVEGAGIPADELRGSSTGVFAG
IMYSDYGGRLLLRTPAEYEGYVGNGSAPSVASGRIAFTFGFEGPALTVDTACSSSLVAVH
LAAQSLRNGECTLALAGGATVMSTPAVFVEFSRQRGLAPDGRCKSFSDSADGTGWGEGAG
MLLLERLSDAERNGHQVLAVLRGSAVNQDGASNGLTAPNGPAQQRVIRQALANARLTGAE
VDAVEAHGTGTTLGDPIEAQALLATYGREHSAEQPLWLGSVKSNLGHTQAAAGVAGIIKM
IQAMRHGVLPRTLHVDEPSRHVEWDDGVVSLLTEQREWPRAGAGRPRRAGVSAFGISGTN
AHVILEEAPAVAQDQPEGEPQPSAAALPWLVSGATPEGLSAQAARLAEQVEAQPELTSSD
LAWSLASRRTALPYRATVLGRDRTELLDGLRAVARDRSAPGVIRTGSEQKPGGLVFMYSG
QGSQRPGMGRELYGVLPEFTEALDEACAALDAHLDIPVREVMFADAADDGSALLDQTLYT
QTGLFALHTALTRQLQAWGVRPDHLIGHSIGELTAAHVAGVLSLADAARLVTARARLMNE
LPHGTGGMLAAQAGPEALAEYLERHGRAEIAAYNSPVATVLAGPADALAALAEELGAAGI
RTRGLKVSHAFHSAQMEPVLAEFTSTAASLTYRAPELPVVSNLTGTAATAGELADAAYWA
EHIRRPVRFHQGLAHLAGEGATAFLEIGPGATLTTLTRAILPTDDGAAVIPALRPARKSP
AADAPAAPADEPTALLHAMGELHAQGMGPRWTDVLPRGRSVELPTYAFQRRRYWIDPEEP
AAAGPAESGLHYRTSWARLPRDGGAVLAGTWLLAVPDSGRAGEWPEFCAGALQGAGAQVT
TVEVAAGTERAALAEQLARRIEETGQPRGILSLLAVRAEPADTAAEAAYAADADPAFDGV
PEELTATVVLTQALGDTGVTAPLWAATREAVSVGDEDPLRNPEAALMWGFGRAAALEEPA
RWGGLVDLPGTPADLGARGRAELAALLGGSPDGSGAPVEDQIALRADGPRARRLRRTTPA
RKADAEWPPRGTVLVTGGTGGLGAHAARRLAADGAEHLLLVSRRGPAAPGADELRAELTA
AGAAVTIAACDVTDRSALAALLAGVPEETPLTAVLHAAGVSADRGLADLDAKHFAEVLGP
KSLAARHLHELTRDADGRSRLSAFVLFSSTAGVWGSGAQGAYAAGNAYLDALAEHRRALG
LPATAVAWGAWSGEGMAGAAENSRRLLRRGIRGLDPAAAAAALADAVRADEPPVTIADID
WSTFTVAFTSRRHSPLLGELPEARAVTGAREAAEPEAAGADAAGQLRALLAGRTREEQQR
ELLDLVRTEVAGVLGHASADSVRPGKPFNDLGFDSLTAVELRNRVNTRTGLRLPTTVIFD
YPSPDALAECLRDELGGPDAAGQSLLADLARLDGALNGAALADEEVRRRAGERLRTMLQR
LDGTAPAASQGAGGDADGGDAGAEANSDLEDASVDDLLDIIQSEFGKS
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGGCCGAGGAAGACAAGCTGCGCGACTACCTCAAACGGCTCACCGTCGACCTGCGCCGG
ACCACGCGCAGGCTGCGGGAGGTGGAGGAGCAGCGGCGGGAGCCGGTCGCGGTCGTCGGC
ATGGCCTGCCGCCTCCCCGGCGGCGTACGGAGCCCCGAGGAACTGTGGGAGCTGCTGCGG
GACGGCCGGGACGCCATCTCCGCCATGCCCGCGAACCGGGACTGGCACCTGGACGACCAC
TTCGACCCGGACCTCGGCCGGCCCGGCACGTCGTACGTGCGCGAGGGCGGCTTCCTCGAC
GACGTCGCCGGCTTCGACGCGGCGTTCTTCGGCATCTCCCCGCGCGAGGCGCTGGCGATG
GACCCGCAGCAGCGGCTCCTGCTGGAGCTGGCATGGGAGAGCGTGGAGCGGGCCGGGATC
GACGCGCACGCGCTGCGCGGCTCGCGTACCGGCGTGTTCGTGGGCAGCAACCCCACCGAG
TACGGCGGTCTGCTCGGTGATGCCGCCGCGCAGGTCGGCGGGCACCTGCTCACCGGCACG
GTCCTCAGCGTGCTGTCCGGCCGGCTCGCGTACACCCTCGGTCTCGAGGGCCCGGCGGTG
AGCGTGGACACCGCGTGCTCCACGTCGCTGACGGCGGTGCACCTCGCGGTGCAGGCGCTG
CGCCGCGGCGAGTGCACGATGGCGCTGGCCGGCGGGGCGACGGTGTTCTCCACGGTCGGT
CCGTTCACCGAGATGAGCCGGCAGCGGGTGCTGGCCGCCGACGGGCGCTGCAAGGCGTTC
GGCGCGGGCGCCGACGGCATGGGCATGTCCGAGGGCGCGGGCGTCGTGCTGCTGGAGCCG
CTCAGCGCGGCCCGCCGCAACGGCCACCGCGTGCTCGCCGTGATCCGCGGCAGCGCCGTC
AACTCCGACGGCTCGTCCAACGGCCTGACGGCGCCGAGCGGGCAGGCCCAGGAGAAGGTG
ATCCGCGCCGCCCTCGCCGACGCGGGCCTCGGTGCCGCCGACGTCGACGCGATCGAGGCG
CACGGCACGGGCACGGAGCTGGGCGACCCGATCGAGGCGCAGGCGCTGCTGGAGGTCTAC
GGCCGCGGCCGGGCCGCGGCCAAGGCGCCGCTGTACCTCGGCTCGGTCAAGTCGAACATC
GGGCACACCCAGGCCGCCGCGGGCGTGGCCGGGCTGATGAAGCTCGTACTGGCGCTGGAG
CACGGGCAGTTGCCCCGTACGCTGCACGCCGACACGCCCAGCCCGCACGTCGACTGGGAC
CCGGCGACGCTCGCGCTGCTGGACGAGGCGCTGCCGTGGCGCGGCGAGGACCGTACGCGG
CGGGCCGCGGTGTCCGCCTTCGGGATCAGCGGCACCAACGCGCACGTGATCGTGGAGCAG
CCCCCGGCCGACGAGCAGGAGCCCGCGGCGCCGGAGGCGTCCGGGAACCCCGTCCGGCCC
TGGCTGGTCTCCGCGGCCACGGCCGACGGGCTGCGCGCGCAGGCGGCCCGGCTGGCCGAC
CACGTCCGCGCCCGCCCGGAGCTGACCGCCGACGCGGTGGGCCACGCGCTGGCGACGTCC
CGGGCCACGCTCGGACACCGCGCCGTGCTCCTCGGCGCCGACCGCGGGGAGTTGCTCGGC
CGGCTCGACGCCCTGGGCCGCGGCGACGCCGCCACCGGGCTGGTCACCGGCGTGCAGCAG
ACCGGGCGGCTGGCACTGATGTTCTCCGGGCAGGGCAGCCAGCGCGCCGGCATGGGGCGC
GAGCTGTACGAGGCGTTCCCGGTGTTCGCCGAGGCGCTGGACGAGGTGTGCGCGGCGCTC
GACGGGCATCTCGACGTCCCCGTACGCGAGGTGATGTTCGCCGCGGCGGGCACCGAGCGG
GCGGCGCTGCTGGAGCACACGCTCTACACCCAGCCCGCGCTGTTCGCGATGCACACCGCG
CTGGCCCGGCTGCTCGCGTCCTGGGGCGTGCGGCCCGACCACCTCATCGGCCACTCCGTG
GGCGAGTTGTCGGCCGCGCACGTCGCCGGGGTCTTCCCGCTCGGCGTCGCCGCCGACATG
GTCGCCACCCGGGCGAAGCTGATGCACTCGCTGCCCGAGGGCACCGGCATGCTCGCCGTA
CGGTCCGGCCCCGAGCCGCTGGCCGGGCAGCTGGAGCGGCACGCGGGGGTGGAGGTCGCC
GCGTACAACTCCCCCGCCGCGACCGCGCTTGCCGGGCCGCTCGACGTGCTGGACGAGCTG
GCGCGGGAGCTGACCGGCGCCGGTGTCCGCGCCAGGCGGCTGCACGTGGCGCACGCCTTC
CACTCCGCGCACACCGAGCCGGTCCTCGACGCCTTCGCGCACCACCTGGCGGACCTCTTC
GACCGCCACGCCCCGGGCGAGGCGGAGGTGCCCGTCATCTCCAACGTCACCGGTCTGCCC
GCGACCAGCGAGCAGCACCGCGACCCCGCGTACTGGGCCGAGCACATCCGCCGCCCCGTC
CGCTTCCACCAGGGCGTCGCCGACCTCGCCGCCCGGGGCACGACGACGTACCTGGAGCTG
GGCCCCGACGCCGGCCTCAGCACCCTCGCGCAGGCGGTGCTCGACGAGGCCGACCCGGCG
CAGCCGGGCGGCGAGCCGGCCGTGGTCACCTCGGTGCTGCGGCGCGCCCACCCCGAGGTC
CCCGCCCTCCTCACCGCGGTCGCCAGGCTGCACGTGCACGGCACGGACGTGGACTGGCGG
GCGCTGCACGCCGACGGCAGGCCGGCGGAGCTGCCGACGTACGCGTTCCAGCGGCGCCCG
TACTGGCTGCGCCAGGCCCGCCCGGCCGCGGACCGGCCCGGCGTACGGGTCACGCGGCAC
CCGCTGCTCGGCGCGGTGCTGGAGACGGCGGACGCCGAGCGGCCGGGCGCGGTGTTCACC
GGCCGGATCAGCGCGCGTACGCCCGGCTGGCTGCCGGACCACGTGCTCGGCACCACCGTG
GTGCTGCCGGGCACGGGCACGGTGGAGGTCGCGCTGTGCGCGGCGCGGCACGTCGGCTGC
GCGCGCGTCGAGGAGTTGACGCTGCGCCACCCGGTGGTGCTGCCGGCGGAGGGCGCGCTG
CAGCTCCAGGTGGCGGTGGCCGCCCCGGACGCCGCCGGCCGCCGCTCCCTGTCCCTGTAC
GCCCGCCCCGAGCCGGACGCGGACGAGGACTCCCCGGAGCTCGCGGCCGACGCCGCGTGG
ACGCTGCACGCGACGGGCGTGCTGGCGCCCGGTGCGACGGCGGCTGCCGATGCGTGGGAC
GGCGCGGCCTGGCCGCCGGCGGGTGAGCCGGCCGCGGTCGTGGACGACCTGTACGACCGG
CTGCACGAGCGCGGGATGCGCTTCGGCCCGGCCTTCCGCTCGCTGCGCACGGTGTGGCGT
ACGGACGAGCACCTGTACGCGGACCTGGCGCTGCCCGAAGCGCACCACGAGGACCTCGAC
GAGTACGGCATCCACCCCGCGCTGCTGGACGCCGCGCTGCACACGGTGGCGCTGCTGGAC
GAGTCGGGCACGGAGCTGCGGCTGCCGTTCGCGTGGTCCGGGGTACGGCTGCTGGCGCGG
CCGGCGCTGCGGTCGCTGCGCGCCCGGGTGACGCCCACCGGCCCGGAGACCGTGGCCCTG
GACCTCGCCGACGCCGCGGGCACGCCGGTGCTGCGGGTGGACGAGGTGGCGCCGCGCCCG
GTGCCGGCCGACAGCCTCGGCGCGGTGTCCGCCGACCCGTTGTACGGGGTCCAGTGGCAG
CGGGTCGACGCGCCGGAGGCCGCGGACGGCGCGGAGTTGCGGGAGACGGACCTCGACGCG
TTCGCCGGGGTCCTCGACGCCGCGGGTGCCGGGTCCGAGGGGTCCGGCGTGTACGTGGTG
CGGTGCCCCGACGCGGACGGCGGCGACGCCGACGGGACGGCGGAGAGGGCCCGTACGACT
GTCGCCCGCGTGCTGACCGCCGTGCAGCGGTGGCTGTCCGACGACCGCTTCGCCGACAGC
CGGCTCGCCGTGGTCACCCGCGGCGCGGTCGGCGCGGACGCGGACGGGGACGTGCCCGCG
CTGGAGTCCGCTCCGGTGTGGGGGCTGCTGCGCTCGGCCCAGTCGGAGCACCCTGACCGG
ATCGTGCTCGTCGACGACGACCCGGGGCAGGGGTCGTCCCTCGACGCCGCGGACGCGGTA
CGGGCCGCGCTGGCGGCCGGCGAACCGCAGGTGGCGATCCGCGGCGGCGGCCTCCTCGCC
CCCAGGCTCACCCGGATCGAACCGGACCGCCCCGCGGCCCTCGACCCGGAGGGCACCGTC
CTGGTCACCGGCGCGAGCGGCACGCTCGGCGGGCAGGTCGCCGCGCACCTCGTCGCGGCC
CACGGCGTACGCCGCCTGCTCCTCGTCAGCCGCCGCGGGCAGGAGGCCCCCGGCGCCGGC
GAACTCCGCGCCGAACTCGCCGGGCTGGGCGCGGAGGTGGCCTTCGCCGCCTGCGACGTC
GCCGACCCGGACGCCCTCGCCGGGGCGCTGGACGCGATCCCGGCGGAGCACCCGCTCACC
GCCGTGGTGCACGCGGCCGGCGTGCTGGACGACGCGACCGTCGGCGAGCTGACGCCCGCC
CAACTCGACGCCGTGCTGCGGCCGAAGACGGACGGCGCCTGGCACCTGCACCGGCTCACC
GCGGACCGGCCGCGGGTGGCGTTCGTGCTGTTCTCGTCGTTCGCATCGGTGGTCGGCACC
CCCGGCCAGGCCAACTACGCCGCCGCGAACAGCTTCCTGGACGCCCTCGCCCAGCACCGC
CGCGCCCGCGGGCTGCCCGCCGTCAGCCTCGCCTGGGGCCTGTGGGAGCAGGGCGGCATG
GGCGAGAGCCTGGACCGGGCCGCCCGGGCGCGTATCGCCCGCGCCGGCGTACGCGCCATG
TCCGCGAGCCGGGCGCTCGCCCTGCTGGACACGGCGCTGCGCAGCCCCGTGGCGCTGGCC
GCCCCCGTGGTCCTCGACCGCCCGGCGCTGCGCGCGCAGTCCCGCGCGGGGACGCTGCCC
GCCGTACTCCGTACGCAGGCGCCCGCACCCGCCGCCCCCGCCGGCGGCAGCGCCGACCCC
GCGGCCCCGGCCGCCGCCGACCCGCTCGCCGGGCTCGCGGCGCTCGGCCGCGCCGAGCAG
GACCGCACACTGCTGGCGCTCGTGCGCCGCACCGCCGTGCTCGCGCTCGGGCTGCCCGAG
GGCGAGTCGGTGAGCCCCGGACAGACCTTCCGCGACCTCGGCTTCGACTCGCTCACCGCC
GTCGAGATGCGCAACCGGCTCAGCGCCGCCACCGGCCGCCGGCTGCCCGCCACCGCGGTC
TTCGACCACCCCACTCCCCAGGCGCTCGCCGACCATCTGCGCACGGAGCTGCTGGGGTCG
GACGGGGCAGCCGCCCCGGCCGCGCCGAAGGCCGCCCCCCGCGCGGCCGACGACGACCCG
ATCGCCGTCGTCGCGATGTCCTGCCGCTACCCCGGCGGCGTGGACTCCCCCGCCGGGCTG
TGGGACCTGCTCAGCAGGGGCGCCGAGGGCACCAGCACGTTCCCGGAGAACCGCGGCTGG
GACATCGACGCGATCTTCGACCCGAGCGGGGAGCGCCCCGGCACCACGTACACGCGCGCC
GGCTCCTTCCTGCACGAGGCCGACCGGTTCGACGCCGAGTTCTTCGGGATCTCGCCGCGC
GAGGCGGCCTCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGCTGTGCTGGGAGGCCGTC
GAGGGCGCCGGCATCCCCGCCGACGAACTGCGCGGCTCCTCGACCGGCGTGTTCGCGGGC
ATCATGTACAGCGACTACGGCGGCCGGCTGCTGCTGCGCACCCCCGCGGAGTACGAGGGG
TACGTCGGCAACGGCAGCGCGCCGAGCGTCGCCTCGGGGCGGATCGCGTTCACCTTCGGC
TTCGAAGGGCCCGCGCTGACCGTCGACACGGCCTGCTCGTCGTCGCTGGTCGCGGTGCAC
CTCGCGGCGCAGTCCCTGCGCAACGGCGAGTGCACGCTGGCCCTGGCCGGCGGTGCGACG
GTGATGTCGACGCCCGCGGTCTTCGTGGAGTTCTCCCGGCAGCGCGGCCTCGCCCCCGAC
GGCCGCTGCAAGTCCTTCTCGGACTCCGCCGACGGTACGGGCTGGGGCGAGGGCGCCGGT
ATGCTGCTGCTGGAGCGGCTCTCGGACGCCGAGCGCAACGGCCACCAGGTGCTCGCGGTG
CTCCGCGGCTCGGCGGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCCAACGGC
CCCGCCCAGCAGCGCGTCATCCGGCAGGCCCTGGCCAACGCCCGGCTGACCGGTGCCGAG
GTCGACGCCGTCGAGGCGCACGGCACCGGCACGACGCTCGGCGACCCGATCGAGGCGCAG
GCGCTGCTGGCGACGTACGGGCGCGAGCACTCGGCCGAACAGCCGCTGTGGCTGGGCTCG
GTGAAGTCGAACCTGGGCCACACGCAGGCCGCGGCCGGCGTCGCCGGGATCATCAAGATG
ATCCAGGCCATGCGGCACGGGGTGCTGCCCCGCACGCTGCACGTCGACGAGCCGTCGCGG
CACGTCGAGTGGGATGACGGCGTCGTCTCGCTGCTGACCGAGCAGCGGGAGTGGCCGCGC
GCCGGGGCCGGCCGGCCGCGGCGGGCCGGCGTGTCCGCGTTCGGGATCAGCGGCACGAAC
GCGCACGTCATCCTGGAGGAGGCGCCGGCCGTCGCCCAGGACCAGCCGGAAGGGGAGCCG
CAGCCGTCCGCTGCCGCGCTGCCCTGGCTGGTCTCCGGCGCGACCCCCGAGGGCCTGAGC
GCCCAGGCCGCCCGGCTGGCCGAACAGGTCGAGGCACAGCCGGAGTTGACCTCGTCCGAC
CTGGCGTGGTCGCTTGCGTCCCGGCGCACCGCCCTGCCGTACCGCGCCACCGTCCTCGGC
CGCGACCGTACGGAACTCCTCGACGGCCTGCGCGCCGTGGCCCGGGACCGGAGCGCGCCC
GGCGTGATCCGCACCGGAAGCGAGCAGAAGCCAGGCGGCCTGGTGTTCATGTACTCCGGC
CAGGGCAGCCAGCGTCCCGGCATGGGCCGCGAACTGTACGGCGTGCTGCCCGAGTTCACC
GAGGCGCTGGACGAGGCGTGCGCCGCGCTCGACGCGCACCTCGACATCCCGGTGCGCGAG
GTGATGTTCGCCGACGCGGCCGACGACGGGTCCGCGCTGCTCGACCAGACCCTCTACACC
CAGACCGGCCTGTTCGCCCTGCACACGGCGCTCACCCGCCAGCTCCAGGCGTGGGGCGTG
CGGCCGGACCACCTGATCGGCCACTCCATCGGCGAGCTGACCGCCGCGCACGTCGCCGGC
GTGCTGTCCCTCGCCGACGCCGCCCGGCTCGTCACGGCCCGGGCGCGGCTGATGAACGAA
CTCCCCCACGGCACCGGCGGCATGCTCGCCGCCCAGGCGGGGCCGGAGGCGCTGGCCGAG
TACCTGGAGCGGCACGGGCGGGCGGAGATCGCCGCGTACAACTCCCCCGTGGCGACGGTG
CTCGCCGGCCCGGCCGACGCGCTGGCCGCGCTCGCGGAGGAGCTGGGCGCGGCCGGGATC
CGGACCCGCGGGCTGAAGGTGAGCCACGCCTTCCACTCGGCGCAGATGGAGCCCGTGCTG
GCCGAGTTCACGAGCACCGCGGCCTCGCTCACGTACCGTGCGCCCGAACTCCCGGTGGTG
TCGAACCTCACCGGCACGGCGGCCACGGCCGGCGAGCTGGCGGACGCCGCGTACTGGGCG
GAGCACATCCGCCGGCCGGTCCGCTTCCACCAGGGCCTCGCCCACCTCGCCGGCGAGGGC
GCCACCGCGTTCCTGGAGATCGGCCCCGGCGCCACCCTGACGACGCTCACCCGGGCGATC
CTGCCGACCGACGACGGCGCCGCGGTGATCCCGGCGCTGCGCCCGGCCCGCAAGTCCCCG
GCCGCCGACGCGCCGGCGGCCCCGGCCGACGAGCCCACCGCGCTGCTGCACGCCATGGGC
GAGCTGCACGCGCAGGGCATGGGCCCCCGGTGGACGGACGTGCTGCCGCGCGGGCGCTCG
GTGGAGCTGCCCACGTACGCCTTCCAGCGCCGCCGCTACTGGATCGACCCGGAGGAGCCC
GCCGCCGCGGGCCCGGCGGAGTCCGGCCTGCACTACCGGACGTCCTGGGCGCGCCTGCCC
CGGGACGGCGGCGCGGTGCTCGCCGGCACCTGGCTGCTCGCGGTGCCGGACAGCGGACGG
GCCGGCGAGTGGCCGGAGTTCTGCGCCGGGGCGCTCCAGGGCGCCGGGGCGCAGGTCACC
ACCGTCGAGGTCGCCGCGGGCACGGAGCGCGCGGCGCTCGCCGAGCAGCTCGCGCGCCGG
ATCGAGGAGACCGGGCAGCCGCGCGGGATCCTGTCGCTGCTGGCCGTACGCGCCGAACCC
GCCGACACCGCCGCCGAAGCCGCGTACGCCGCCGACGCGGACCCCGCCTTCGACGGCGTA
CCGGAGGAGCTGACCGCGACCGTCGTCCTCACCCAGGCGCTCGGCGACACCGGCGTGACC
GCTCCCCTGTGGGCGGCCACCCGCGAGGCCGTCTCCGTCGGCGACGAGGACCCGCTCCGC
AACCCGGAGGCCGCCCTGATGTGGGGCTTCGGCCGGGCCGCGGCGCTCGAGGAGCCCGCG
CGCTGGGGCGGGTTGGTCGACCTCCCCGGCACGCCCGCCGACCTCGGCGCGCGCGGACGC
GCGGAGCTGGCCGCGCTGCTCGGCGGCTCGCCGGACGGCTCCGGCGCGCCGGTGGAGGAC
CAGATCGCGCTACGGGCCGACGGGCCGCGGGCGCGGCGGCTCAGGCGTACGACGCCCGCC
CGCAAGGCGGACGCCGAGTGGCCGCCCCGCGGCACCGTCCTCGTCACCGGCGGCACCGGC
GGCCTCGGCGCCCACGCCGCCCGCCGGCTGGCCGCGGACGGCGCCGAGCACCTGCTCCTC
GTCAGCCGCCGCGGCCCCGCCGCCCCGGGCGCCGACGAGCTGCGCGCCGAACTGACGGCG
GCCGGCGCCGCCGTGACGATCGCCGCCTGCGACGTCACCGACCGCTCCGCCCTCGCCGCG
CTGCTCGCCGGCGTACCCGAGGAGACACCGCTCACCGCGGTGCTGCACGCGGCCGGCGTC
AGCGCGGACCGCGGGCTGGCGGACCTGGACGCCAAGCACTTCGCCGAGGTCCTCGGCCCC
AAGTCCCTCGCGGCACGCCACCTGCACGAGCTGACCCGGGACGCGGACGGCCGCAGCCGG
CTCAGCGCCTTCGTGCTGTTCTCGTCGACCGCGGGCGTGTGGGGCAGCGGCGCCCAGGGC
GCGTACGCCGCGGGCAACGCCTACCTCGACGCGCTCGCCGAGCACCGCCGCGCCCTCGGC
CTGCCCGCCACCGCGGTGGCCTGGGGCGCGTGGAGCGGCGAGGGCATGGCAGGCGCCGCG
GAGAACTCGCGGCGCCTGCTGCGCCGCGGCATCCGCGGTCTCGACCCGGCCGCCGCGGCG
GCGGCCCTCGCCGACGCCGTACGGGCGGACGAGCCCCCGGTGACGATCGCCGACATCGAC
TGGTCGACATTCACCGTGGCGTTCACGTCGCGGCGGCACAGCCCGCTGCTCGGCGAGCTG
CCGGAGGCCCGGGCGGTGACCGGCGCGCGGGAGGCGGCCGAGCCGGAGGCGGCGGGCGCC
GATGCCGCCGGGCAGCTGCGGGCGCTGCTCGCGGGCCGTACCCGCGAGGAGCAGCAGCGC
GAGCTGCTGGACCTGGTGCGTACGGAGGTCGCGGGCGTGCTCGGGCACGCGTCGGCCGAC
AGCGTACGGCCCGGGAAGCCCTTCAACGACCTGGGCTTCGACTCGCTCACCGCCGTCGAG
CTGCGCAACCGCGTCAACACCCGGACCGGGCTGCGGCTGCCGACGACGGTCATCTTCGAC
TACCCGTCGCCGGACGCCCTCGCCGAGTGCCTCCGCGACGAACTCGGCGGCCCCGACGCC
GCCGGGCAGTCCCTGCTCGCCGACCTGGCGCGGCTCGACGGCGCGCTGAACGGCGCGGCG
CTGGCCGACGAGGAGGTGCGGCGCCGGGCCGGGGAGCGGCTGCGGACGATGCTCCAGCGG
CTCGACGGAACCGCGCCGGCCGCCTCGCAGGGGGCGGGCGGCGACGCGGACGGCGGTGAT
GCCGGCGCGGAGGCGAACAGCGACCTGGAGGACGCGTCCGTCGACGACCTCCTCGACATC
ATCCAGTCGGAGTTCGGCAAGTCATGA
[4] KS34..410
[4] AT567..896
[4] malonyl-CoA758..762
[4] DH940..1115
[4] KR1418..1598
[4] ACP1704..1774
[5] KS1799..2176
[5] AT2335..2641
[5] malonyl-CoA2529..2533
[5] KR2951..3134
[5] ACP3242..3312
[4] KS100..1230
[4] AT1699..2688
[4] malonyl-CoA2272..2286
[4] DH2818..3345
[4] KR4252..4794
[4] ACP5110..5322
[5] KS5395..6528
[5] AT7003..7923
[5] malonyl-CoA7585..7599
[5] KR8851..9402
[5] ACP9724..9936

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-691]  G3DSA:3.40.366.10 [758-886]  G3DSA:3.40.366.10 [2334-2458]  G3DSA:3.40.366.10 [2528-2636]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1732-1747]  PS00012 [3270-3285]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1703-1777]  4.39999999999997e-46 G3DSA:1.10.1200.10 [3239-3316]  4.39999999999997e-46 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1704-1774]  PS50075 [3242-3312]  PS50075
PS50075   ACP_DOMAIN
 [1697-1815]  8.49999291746323e-27 SSF47336 [3234-3329]  3.49999466863949e-23 SSF47336
SSF47336   ACP_like
 [1709-1773]  2.1e-12 PF00550 [3245-3311]  3.4e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1418-1597]  1.70000000000001e-62 PF08659 [2951-3133]  7.29999999999999e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1.10000000000001e-89 PF00109 [1799-2050]  8.49999999999995e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  9.40000000000003e-46 PF02801 [2058-2176]  5.69999999999998e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [567-896]  1e-60 PF00698 [2335-2641]  1.9e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.9e-10 PF08990
PF08990   Docking
 [4-34]  1.9000006847787e-07 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [563-872]  3.80000697093588e-60 SSF52151 [2333-2640]  1.09999184471405e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [693-757]  3.50000235434314e-13 SSF55048 [2464-2528]  1.69999922284049e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-295]  G3DSA:3.40.47.10 [296-463]  2.39999999999997e-129 G3DSA:3.40.47.10 [1799-2060]  G3DSA:3.40.47.10 [2062-2230]  2.39999999999997e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-409]  8.89993011983204e-102 SSF53901 [1791-2174]  4.40002866058555e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1418-1621]  1.20000000000001e-71 G3DSA:3.40.50.720 [2951-3170]  1.10000000000001e-73 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1963-1979]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [567-877]  7.49999605851445e-102 SM00827 [2337-2637]  3.89999861795218e-113 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1705-1777]  1.10000150671642e-31 SM00823 [3243-3315]  2.19999900980707e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [940-1115]  2.89997807423187e-66 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825 [1801-2230]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1418-1598]  9.60004130884281e-58 SM00822 [2951-3134]  1.60000240695997e-47 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit