close all open/close all

CDS information : Tetrn_00160


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction47,265 / 64,238 / + [in whole cluster]
47,265 / 64,238 / + [in contig]
Location47265..64238 [in whole cluster]
47265..64238 [in contig]
TypeCDS
Length16,974 bp (5,657 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)tmnAIV
EC number
Keyword
Note
Note (GenBank)
  • module 6 (KS, AT-P, DH, ER, KR, and ACP); module 7 (KS, AT-P, DH, KR, and ACP); module 8 (KS, AT-A, DH, KR, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

6 methylmalonyl-CoA
7 methylmalonyl-CoA
8 malonyl-CoA
KS34..409
AT577..892
DH944..1118
ER1422..1726
KR1736..1916
ACP2017..2087
KS2114..2490
AT2650..2964
DH3017..3197
KR3487..3667
ACP3769..3839
KS3862..4239
AT4398..4688
DH4760..4936
KR5220..5400
ACP5502..5572

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MKNEQKLLDNLKWVTAELRQARRRLGEVESKSAEPIAIVSMACRYPGGVASPEDLWRMVA
EGRDGIVELPGDRGWPEDLYDPDPAASGKSSTRMGAFLEGVEQFDAELFGISPREALAMD
PQQRLLLETAWEAFERAGLDPAGVKGNRTGVFAGLNSQDYLLRLYRATGDLEGYAATGSA
GSVASGRVAYTFGLEGPAVTVDTACSSSLVALHLAIQALRNGECDSALAGGATVMSSPSA
FTVFSRQRGLAADGRCKAFAEAADGTGWGEGVGLVLLERLSDAQRNGHTVLAVLKGSAIN
QDGASNGLTAPNGPSQRRVIEQALANARLTPGQVDAVEAHGTGTTLGDPIEAQALLATYG
REHTAEQPLWLGSVKSNVGHTQAAAGVAGVIKMVEAMRHGVLPPTLHVDRPTSHVDWESG
TVSLLTETQEWPETGQPRRAAVSSFGMSGTNAHLILEAAPVAAPEEAEASPEAAPETEAA
EAARSLPVPVVVSARTAAALAESAGRLAAYVERHPQVEVGALASGLWSGRAKMEHRAGVV
TADRDELLEALTALATGSAHAALVTGPGSVSAGKTAFVFPGQGSQWTRMGYDLAAEEPAF
AAHLAACRDELSRWCDWDLLEVLASEDEDALDRVDVVQPALFAVMTGIAQLLRHHGVEPD
AVIGHSQGEIAAAYVAGALTLSDAVAVVALRAQAITRLAGTGTMASFPLPQDELGDLPEG
VYVAAVNGPHTTILAGETHPLTDLVNTYQEREIRARLIPVDYASHTPHVEDLRETILGDL
TQRADIKPVAPSIPFYSTHTGTLLAEDRLLDAEYWFDNLRHPVHFHTTLEQLLGDGHHTL
IESSPHPVMTAALADTFEQHATPAHHHATLIRNNGTQTRFLTALTTLHTHHHPVSLGPHL
PPVDESVELLHGLPTYPFQHQPYWLDAPAQLTSATDLGLSSTTHPLLSAAVQLADTTGAA
ETGASTMVFTGRLGLATHPWLADHAVAGTVLLPGTALVDLALHTGDHTGATHLEELTLHA
PLTLEEAGARDLQVTAAPIPDGRGGRQVTIHSRPHTDDEAEPESWTCHATGTLTAEPAAA
AESLGQWPPAGAQALDVSELYPQMAAAGYGYGPAFRGVTAAWAQPDGTLHAEIALPADTD
ADGHTVHPALLDAALHPLALRALAKGGAAKDEAQELRLPFAWSGVSVHATGATRLRATLV
PTGEQGHDLTLHAWDPTGAPVATITALNTRPIDPGALTSGGADTGAATRNSLFQLAWTPP
QPRQDDSDRIDPDLVDLYVAPRPAEDTPAAAHAATEALLTHLQGWLADNDETDRRLVVLT
HRAVATGPAEDVHLAHAPLWGLVRTAQNEQPDRIHLIDTDTEVDAAAVTDVPQLADALAE
GEPQLALRHGQFLVARLVRATGAGGALAMPESTWKLATGGDGTLEAVTCRPMPEWDGPLA
GGQVRVRLHAIGLNFRDTLIALGMYPGDAPLGSEGAGIVTGVADDVTGFAVGDRVMGVMI
DGAGSHAVTDHRLLTTVPEQWGSTQAAGIPVAFLTAYYALKDLGRLEAGESLLLHAATGG
VGSAALQLARHFGADVYATASPGKHHLLRAQGLDDAHIASSRSLDFEDHFRTHGPDQGVD
VVLNALAHEFTDASLRLARPGGRFIEMGKTDVRDADTVQTEHQVQYRNFDLIEAGPDRIQ
QILAHLTELFAEGHLTPLPTASFDVRHTPQALRHLSQARHTGKLILTLPRALDPDGTVLI
TGGTGVLAGLTARHLITEHGVRHLLLASRSGPDHPAAAALSEELEALGAEITVTACDVTD
PDAVHALVDSVDEHHPLTAVIHTAGALNDTVLTQLTPENLHPVLEPKVDAAHHLHEATRH
LPLAHFVVYSSAAGTLGNPGQANYAAANAYLDALAHRRTRQGLPATSLAWGYWKQASGLT
GHLSDNEVRNVTHGTTPLEADHAFRLFDAALAGPEAYQLCLPLNPAALRTAPRLPSLLRD
VVPRPSRRVAATSAAGDGNALAEQLAALPEAEQERRLLDLVRSNVAAVLGHGTGDAIDAQ
RPFKELGFDSLTAVELRNRLTNATALRLPATLIFDHPTPQALTRHLLGQFLDTGSLTSRA
GSRAGTAVAAVTDDPIAIVSMACRYPGGVRDSQALWDLVSTGREAIGDLPTNRGWDLENL
YDPDPDATGKVYTRHGAFLHDADLFDADFFHMNPREALATDPQQRLLLETSWEAFERAGI
DPAALHGSNTGVFAGVISQDYLLRLHQNPEGLEGYIATGSSGSVASGRIAYTFGLEGPAM
TVDTACSSSLVALHLAMQALRNGECDLALAGGATIMATPGTFQVFSRQRGLAADGRCKPF
ADAADGTGWGEGAGLLLLERLSDAERNGHRVLAVLKGSAINQDGASNGLTAPNGPSQQRV
IEQALANSGLTAEQIDVVEAHGTGTTLGDPIEAQALLATYGQAHTEEQPLWLGSIKSNIG
HTQAASGVAGVIKMVEALRHGRLPQTLNVDRPSTHVEWDTGHVSLLTETQEWPETGRPRR
AAVSSFGMSGTNAHLILEAASARPASGEAADGDEPGSGAAVPVVVSARTAGALAQAAEQL
AEYVEQHPEIEVGPLAARLWSGRAKMEHRAGVVTADRDELLEALTALATGSAHAALVTGP
GSVSAGKTAFVFPGQGSQWTRMGYDLAAEEPAFAAHLAACRDELSRWCDWDLLEVLASED
EDALDRVDVVQPALFAVMTGIAQLLRHHGVEPDAVIGHSQGEIAAAYVAGALTLPDAVAV
VALRAQAITRLAGTGTMASFPLPQDELGDLPEGVYVAAVNGPHTTILAGETQPLADLVSS
YQEREIRARLIPVDYASHTPHVEDLRETIITDLAERAGIEPMPPTIPFYSTHTGALLAED
RLLDAEYWFDNLRHPVHFHTTLEQLLDDGHHTLIESSPHPVMTAALADTFEQHATPAHHH
ATLIRNNGTQTRFLTALTTLHTHHHPIDLTPHLPAAGLSGDELPELPTYPFQRDSYWIQS
SAQLTSATDLGQISSAHALLSAAVQLADGNEDSGDGTRGAYTTTVFTGRVSLGTHSWLAD
HAVAGTVLLPGTALIDLALHAGDHTGATHLEELTLQAPLLLDEAARDLQVTTSPEAGAED
GGPVRRQVTIHSRPHTDDAEPEPWTCHATGTLTAEPAEAAQPLTQWPPTGAQRLDTTGLY
ARMAAAGYEYGPAFQGVTAAWAHPDGSLHAEIGLAEDADTAGHTIHPALLDATLHPLATR
SLDEDGDAAQELRLPFAWSGVSVHATGATHLRATITPTGEHGHDLTLHAWDPTGAPVATI
TALNTRPIDPGALTGNARTGAATRNSLFHVAWSPAPAEPVEQVDLDQVDVYVAVPAAEDT
PAAAHVATEALLTHVQNWLADNDQSDRQLVVLTHRAVATDAAEDVHLAHAPLWGLVRTAQ
NEQPDRIRLIDTDAAGIRGNAADIPQLAEALATGEPQLALRDGRVLTPRLTRSTATDAAA
RPLDPEGTVLITGGTGGLASLTARHLITEHGVRHLLLASRSGPDHPNAPALTDELTALGA
QVTVTACDTTDADQVTALIAAIDGDHPLTAVIHTAGALNDATLAKLTPDELHPVLAPKVD
AAYHLHQATKHLDLAHFVLYSSAAGTLGNPGQANYAAANTYVDALAHDRTRQGLPTTSLA
WGYWEQATGLTSHLSDNEVRNVTHGTTALTAEHALHLLDTALTTPQPHHLCVPVTPSALR
NPDRLPVLFRGLASRPARRAAAGSAAGDGNALAERLAALSEPEQQHKVVLDVVRSNIAAV
LGHGTADTIDPHRPFKELGFDSLTAVQLRNQLTTTTALRLPATLIFDHPTPEALTRHLLG
RLLDSAPARARTVTTRTVTDDDPIAIVSMACRYPGEVRSADDLWRLVADGTDAVSEFPVN
RGWDLDNLYDPDPDATGRTYTRHGAFLHDADRFDADFFHMNPREALATDPQQRLLLETAW
EAFEQAGIDPAGLRDSNTGVFTGVIYADYGPRLMHRTPEGFEGYLGNGSAASVASGRVAY
TFGLEGPAMTVDTACSSSLVGMHLAAQALRNGECDLALAGGVTVMSTPSAFLEFSRQRGL
AADGRCKPFADAADGTGWGEGAGLVLLERLSDARRNGHEVLAILRGSAVNQDGASNGLTA
PNGPSQQRVIEQALANAGLSAGQVDAVEAHGTGTTLGDPIEAQALLATYGQAHTEEQPLW
LGSIKSNIGHTQAAAGVAGVIKMVEALRHGHLPQTLHVDEPSTHVEWDTGHVALLTEGQP
WPETGEARRAAVSSFGISGTNAHVILEAAPEPGKPVEERVDKSMPVPVVVSARSTAALAE
SAGRLAAYVEHHPDVEIGALAARLWSGRAKLEHRAGVITSDRTELHEALTALAAGTTHPA
LVTGPGSAETGGRLAVMFSGQGSQRPGMGRDLYETIPAYAEALDEVCTALDEHLATGTSL
REVMFAEPGSEHAALLETTLYTQPALFAHHVAGYRLLQKAGVQPAALIGHSIGELSAAHL
TGVLPLAVAADMVATRAKLLHTLPDGTGMLAVQSAPEPLTEYLDRHAQVEIAAYNSEVST
ALAGPLDALDELGRELTEAGIRTKTLKVAHAFHTAHTEPILDTFTNHLTDLFNRHTLGDA
DIPVISNITGQPATSGQHHDPAYWAQHIRQPVHFHQGITHLTTDSVSLFTEVAPHPTLAA
HLPVGVRSTPHLPDETRTHLAALTALHAHHHPADLALRLPRSGGGLPSLPTYPFQSLPYW
LDLPAQVTSATDLGQATTTHPLLHAAVQLADGVDESAATTVFTGRVSLKTHPWLADHAVA
GTVLLPGTALVDLALHAGDHTGATHLEELTLHAPLTLDEAGTHDLQVTASVRGGSDDEGE
GAGRWQVTVHSRRTSDNAEPEPWTHHATGALTTEPAEQAAPLAQWPPTGAEPVEVTDLYP
RLLAAGYEYGPAFQGVTAAWAHPDGTLHAEISLAEDTDVTGHAIHPALLDAAIHPLATRT
LLADSKAAELRLPFAWTGVTVHATGATELRATLTPTGEHGHDLALRTWDTTGAPVATITA
LNTRPVDATALAGAPHANTATRNSLFHLAWRSAATPQDQAQVDLDRVDVYAAAPAEDDSP
AAAHTATEALLTHLQSWLAKNDATDRQLVVLTHRAVATGPAEDVHLAHAPLWGLVRTAQN
ENPDRIHLIDTDTDNTPDLTAALATGEPQLALRNGDILIPRLTRSTDSAATEPRPLDPDG
TVLITGGTGGLASLTARHLITEHGVRHLHLASRSGPDHPNAPALTDELTALGAQVTLTAC
DTTDADQVTALIAAIDGDHPLTAVIHTAGVLNDAVLGKLTADGLHSVLAPKVDAAYHLHR
ATMGLDLAHFVVYSSAAGILGNPGQANYAAANTYLDALAHHRTRQGLPTTSLAWGYWKQA
TGLTSHLSDNEVRNVTHGTTPLTTDHALHLLDTALTTPQPHHLCTPLNPSTLRTTPHLPA
LLRDLVPAPRRTAARAHGAQPSGADLADRLRALPPEGQQKLLLDVVCSAVAAVLGHGGAD
AIDPYRPFNELGFDSLTAVQLRNRLTEATGLRLTSTLIFDYPTPNDLARYVGEGIGPDET
SVETSFLAEIDKLELTLIDRSAEDAGRVKVTRRLQALLTRLNETAGSAPAGEDIETKLRS
ASNDELFDLLDGDLDLS
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGAAGAACGAGCAGAAGCTTCTGGACAACCTGAAGTGGGTGACCGCGGAGCTGCGCCAG
GCCCGCCGCCGCCTCGGCGAGGTCGAGTCGAAGTCCGCGGAGCCCATCGCCATCGTGTCC
ATGGCCTGCCGCTACCCCGGCGGCGTGGCCTCGCCCGAGGACCTGTGGCGGATGGTGGCC
GAGGGCCGCGACGGGATCGTGGAACTCCCGGGCGACCGCGGCTGGCCGGAGGACCTGTAC
GACCCGGACCCGGCGGCGAGCGGCAAGAGCTCCACGCGCATGGGCGCCTTCCTCGAAGGG
GTCGAGCAGTTCGACGCGGAGCTGTTCGGCATCTCACCGCGCGAGGCGCTGGCCATGGAC
CCGCAGCAGCGGCTGCTGCTGGAGACGGCCTGGGAGGCGTTCGAGCGGGCGGGCCTGGAC
CCGGCGGGGGTGAAGGGCAACAGGACGGGCGTCTTCGCGGGGCTCAACTCCCAGGACTAC
CTGCTGCGCCTCTACCGCGCCACCGGCGACCTGGAGGGCTACGCGGCGACCGGCAGCGCC
GGCAGCGTGGCGTCCGGCCGGGTGGCGTACACCTTCGGGCTCGAGGGCCCGGCGGTGACG
GTGGACACGGCGTGCTCGTCGTCCCTGGTGGCCCTGCACCTGGCGATCCAGGCGCTGCGC
AACGGCGAGTGCGACAGCGCGCTGGCGGGCGGCGCGACGGTCATGTCCAGCCCGTCCGCC
TTCACGGTCTTCTCCCGGCAGCGCGGCCTGGCCGCGGACGGCCGGTGCAAGGCGTTCGCC
GAGGCGGCGGACGGCACGGGCTGGGGCGAGGGCGTCGGCCTCGTACTGCTGGAGCGGCTG
TCGGACGCGCAGCGCAACGGGCACACGGTGCTGGCGGTGCTCAAGGGCTCCGCGATCAAC
CAGGACGGTGCCTCCAACGGCCTCACCGCCCCCAACGGGCCGTCGCAGCGCCGGGTCATC
GAGCAGGCGCTGGCCAACGCCAGGCTGACGCCCGGTCAGGTGGACGCCGTCGAGGCGCAC
GGCACGGGTACGACGCTGGGCGACCCGATCGAGGCGCAGGCCCTGCTGGCGACCTACGGG
CGCGAGCACACAGCGGAGCAGCCGCTGTGGCTGGGCTCGGTGAAGTCGAACGTCGGGCAC
ACGCAGGCCGCGGCGGGGGTGGCCGGCGTCATCAAGATGGTCGAGGCCATGCGTCACGGG
GTGCTGCCGCCCACGCTGCACGTGGACCGGCCGACGAGCCACGTGGACTGGGAGTCGGGC
ACCGTCTCGCTGCTGACGGAGACGCAGGAGTGGCCGGAGACGGGGCAGCCGCGGCGTGCG
GCAGTGTCCTCGTTCGGCATGAGCGGCACCAACGCGCACCTGATCCTGGAGGCCGCGCCG
GTCGCGGCACCGGAGGAGGCAGAGGCGTCGCCGGAGGCGGCACCGGAGACGGAGGCGGCC
GAGGCCGCGCGGTCCCTGCCGGTGCCGGTCGTGGTCTCCGCCCGTACGGCGGCGGCACTG
GCGGAGTCGGCCGGGCGGCTGGCTGCGTACGTGGAGCGGCACCCGCAGGTCGAGGTGGGT
GCGCTGGCGTCTGGGCTGTGGTCCGGTCGCGCGAAGATGGAGCACCGTGCGGGTGTGGTC
ACGGCCGATCGGGACGAGTTGCTGGAGGCGCTGACCGCGCTGGCCACCGGTTCCGCGCAC
GCGGCGCTGGTCACCGGCCCGGGATCGGTGTCTGCCGGGAAGACCGCGTTCGTGTTCCCG
GGGCAGGGTTCGCAGTGGACCCGTATGGGCTACGACCTCGCGGCGGAGGAGCCCGCGTTC
GCGGCGCACCTGGCCGCGTGCCGGGACGAGTTGTCACGTTGGTGCGACTGGGACCTCCTC
GAAGTCCTCGCCAGCGAGGACGAGGACGCCCTCGACCGTGTTGACGTCGTGCAGCCCGCA
CTGTTCGCCGTCATGACCGGCATCGCCCAGCTCCTGCGCCACCACGGCGTCGAACCCGAC
GCGGTCATCGGCCACTCCCAGGGCGAGATCGCCGCCGCCTACGTCGCCGGCGCACTCACC
CTCTCCGACGCCGTCGCCGTCGTGGCGCTGCGGGCCCAGGCCATCACCCGCCTCGCCGGC
ACCGGCACCATGGCCTCCTTCCCCCTCCCCCAGGACGAGTTGGGCGACCTGCCCGAAGGC
GTCTACGTGGCCGCGGTCAACGGACCGCACACCACCATCCTCGCCGGAGAAACCCATCCG
CTGACGGATCTGGTCAACACCTACCAGGAGCGCGAGATCCGGGCGCGGCTGATCCCGGTT
GACTACGCCTCGCACACCCCCCATGTCGAAGACCTGCGCGAGACGATCCTCGGCGACCTG
ACCCAGCGCGCCGACATCAAGCCCGTGGCTCCGAGCATCCCGTTCTACTCCACCCACACC
GGCACCCTCCTCGCGGAAGACCGACTGCTGGACGCGGAGTACTGGTTCGACAACCTCCGC
CACCCCGTCCACTTCCACACCACACTCGAACAACTCCTCGGCGACGGCCACCACACCCTC
ATCGAGTCCAGCCCTCACCCGGTCATGACCGCCGCCCTGGCCGACACCTTCGAACAGCAC
GCCACCCCCGCCCACCACCACGCCACCCTCATCCGCAACAACGGCACCCAAACCCGCTTC
CTCACCGCCCTCACCACCCTCCACACCCACCACCACCCCGTCAGCCTCGGTCCGCACCTC
CCGCCTGTCGACGAGTCCGTCGAGCTGCTGCACGGGCTGCCCACCTACCCGTTCCAGCAC
CAGCCCTACTGGCTGGACGCTCCGGCCCAGCTGACCAGCGCCACCGACCTCGGCCTGAGC
AGCACCACGCACCCCCTCCTCAGCGCCGCCGTCCAACTCGCCGACACCACCGGTGCTGCG
GAGACCGGTGCCAGCACGATGGTGTTCACCGGCCGCCTCGGCCTGGCCACGCACCCCTGG
CTCGCCGACCACGCGGTTGCGGGTACGGTCCTGCTGCCCGGCACCGCCCTCGTGGACCTC
GCCCTGCACACCGGCGACCACACCGGCGCCACCCACCTCGAAGAGCTGACCCTCCACGCC
CCGCTGACGCTCGAGGAGGCCGGCGCCCGCGACCTCCAGGTCACCGCCGCGCCGATCCCC
GACGGCCGGGGCGGTCGGCAGGTCACGATCCACTCCCGTCCCCACACCGACGACGAGGCC
GAGCCCGAGTCCTGGACGTGCCACGCCACCGGCACGCTCACCGCGGAACCGGCCGCGGCG
GCCGAGTCGTTGGGCCAGTGGCCGCCCGCCGGGGCGCAGGCCCTCGACGTCTCCGAGCTG
TACCCGCAGATGGCTGCGGCCGGGTACGGGTACGGGCCCGCCTTCCGCGGCGTGACCGCC
GCCTGGGCGCAGCCCGACGGCACCCTCCACGCCGAGATCGCCCTCCCCGCCGACACGGAC
GCCGACGGGCACACCGTCCACCCGGCCCTGCTCGACGCCGCCCTCCACCCGTTGGCCCTC
CGCGCCCTCGCCAAGGGCGGCGCCGCGAAGGACGAGGCGCAGGAGCTGCGGCTGCCGTTC
GCGTGGAGCGGTGTGTCCGTCCACGCCACTGGCGCCACCCGGCTCCGCGCCACCCTCGTA
CCCACCGGCGAACAGGGCCACGACCTCACCCTCCACGCCTGGGACCCCACCGGCGCCCCC
GTCGCCACCATCACCGCCCTCAACACCCGCCCCATCGACCCCGGTGCGCTGACCAGCGGT
GGTGCCGACACCGGTGCCGCGACACGCAACAGCCTCTTCCAGCTCGCCTGGACCCCGCCG
CAGCCTCGGCAGGACGACTCCGACCGCATCGATCCGGACCTGGTGGACCTCTACGTCGCC
CCCCGGCCCGCGGAGGACACGCCGGCCGCGGCCCACGCCGCGACCGAAGCGCTGCTCACC
CACCTCCAGGGCTGGCTGGCCGACAACGACGAGACGGACCGCCGCCTCGTCGTCCTCACC
CACCGCGCCGTCGCCACCGGCCCGGCCGAGGACGTGCACCTGGCGCACGCGCCGCTGTGG
GGCCTGGTCCGTACCGCACAGAACGAACAGCCCGACCGCATCCACCTCATCGACACCGAC
ACCGAGGTGGACGCGGCGGCGGTCACCGACGTACCGCAGCTCGCCGACGCCCTCGCCGAG
GGCGAGCCGCAGCTCGCCCTCCGCCACGGGCAGTTCCTCGTCGCGCGCCTGGTGCGCGCG
ACCGGCGCCGGCGGGGCGCTCGCGATGCCGGAGAGCACCTGGAAGCTGGCCACCGGGGGC
GACGGCACGCTGGAGGCGGTCACCTGCCGGCCGATGCCGGAGTGGGACGGGCCGCTGGCC
GGCGGGCAGGTGCGCGTACGACTGCACGCGATCGGCCTCAACTTCCGCGACACGCTCATC
GCCCTGGGCATGTACCCCGGCGACGCGCCGCTCGGCAGCGAGGGCGCGGGTATCGTCACC
GGCGTCGCCGACGACGTCACCGGTTTCGCCGTGGGCGACCGGGTGATGGGCGTGATGATC
GACGGCGCGGGCTCCCACGCCGTCACCGACCACCGCCTGCTGACCACCGTGCCCGAGCAG
TGGGGGTCCACCCAGGCGGCGGGCATTCCGGTGGCGTTCCTCACCGCGTACTACGCGCTG
AAGGACCTGGGCCGCCTGGAGGCCGGCGAGTCACTGCTGCTGCACGCCGCGACCGGCGGC
GTCGGCTCCGCCGCGCTCCAACTCGCCCGCCACTTCGGCGCCGACGTCTACGCCACCGCC
AGCCCCGGCAAGCACCACCTGCTGCGCGCCCAGGGCCTGGACGACGCGCACATCGCGTCC
AGCCGGAGCCTGGACTTCGAGGACCACTTCCGCACCCACGGCCCCGACCAGGGCGTCGAC
GTGGTCCTCAACGCCCTCGCCCACGAGTTCACCGACGCCTCCCTGCGCCTTGCACGTCCC
GGCGGCCGGTTCATCGAGATGGGCAAGACGGACGTCCGCGACGCCGACACCGTGCAGACG
GAGCACCAGGTCCAGTACCGGAACTTCGACCTCATCGAGGCCGGCCCGGACCGCATCCAG
CAGATCCTGGCCCACCTCACCGAGCTGTTCGCCGAAGGCCACCTCACCCCGCTGCCCACG
GCCTCGTTCGACGTACGGCACACCCCGCAGGCTCTACGCCATCTCAGCCAGGCCCGGCAC
ACGGGCAAGCTGATCCTGACCCTGCCGCGGGCGCTCGACCCGGACGGTACGGTCCTGATC
ACCGGCGGCACCGGCGTCCTCGCCGGCCTGACGGCCCGCCACCTGATCACCGAACACGGC
GTACGCCACCTCCTCCTCGCCTCCCGCAGCGGCCCCGACCACCCGGCCGCCGCAGCACTC
AGCGAAGAACTCGAAGCGCTCGGCGCCGAGATCACCGTCACGGCCTGCGACGTCACCGAC
CCCGACGCCGTACACGCCCTCGTCGACTCCGTCGACGAACACCACCCGCTCACGGCAGTC
ATCCACACCGCGGGCGCCCTGAACGACACCGTCCTCACGCAGCTCACCCCCGAGAACCTG
CACCCGGTCCTCGAACCGAAGGTCGACGCCGCCCACCACCTGCACGAGGCGACGCGGCAC
CTGCCCCTGGCGCACTTCGTCGTGTACTCCTCCGCCGCCGGCACCCTGGGCAACCCCGGC
CAGGCCAACTACGCCGCCGCCAACGCCTACCTGGACGCCCTCGCCCACCGCCGCACCCGG
CAGGGCCTGCCCGCCACCAGCCTCGCCTGGGGCTACTGGAAGCAGGCCAGCGGCCTCACC
GGCCACCTCAGCGACAACGAGGTCCGCAACGTCACCCACGGCACCACCCCGCTCGAAGCC
GACCACGCTTTCCGCCTGTTCGACGCGGCCCTCGCCGGCCCCGAGGCGTACCAGCTCTGC
CTTCCGCTCAACCCCGCCGCACTGCGCACGGCCCCCCGTCTCCCCTCGCTGCTGCGCGAC
GTCGTCCCCCGGCCGTCCCGCCGTGTCGCCGCCACCTCGGCGGCGGGCGACGGCAACGCG
CTCGCCGAGCAGCTCGCCGCGCTCCCCGAGGCCGAGCAGGAGCGCCGTCTGCTGGACCTG
GTCCGCAGCAACGTCGCCGCGGTCCTCGGCCACGGCACCGGCGACGCGATCGACGCGCAA
CGCCCGTTCAAGGAGCTGGGCTTCGACTCCCTCACCGCCGTCGAACTCCGCAACCGCCTC
ACGAACGCGACCGCGCTGCGCCTTCCCGCGACCCTGATCTTCGACCACCCGACCCCCCAG
GCACTGACCCGCCACCTCCTCGGCCAGTTCCTGGACACCGGGTCGCTCACCTCCCGGGCC
GGGAGCCGCGCCGGCACCGCCGTGGCCGCCGTCACCGACGACCCGATCGCGATCGTCTCG
ATGGCCTGCCGCTATCCCGGCGGCGTACGCGACTCGCAGGCGCTCTGGGACCTCGTCAGC
ACCGGTCGCGAAGCCATCGGCGACCTGCCGACCAACCGCGGCTGGGACCTGGAGAACCTG
TACGACCCGGACCCCGACGCGACGGGCAAGGTCTACACCCGGCACGGGGCGTTCCTGCAC
GACGCCGACCTGTTCGACGCGGACTTCTTCCACATGAACCCGCGTGAGGCGCTGGCCACG
GACCCGCAGCAGCGGCTGCTGCTGGAGACCTCGTGGGAGGCGTTCGAGCGGGCGGGCATC
GACCCCGCGGCGCTCCACGGCAGCAACACCGGTGTGTTCGCGGGCGTCATCTCCCAGGAC
TACCTGCTGCGGCTGCATCAGAACCCGGAGGGGCTGGAGGGCTACATCGCCACCGGCAGC
TCGGGCAGCGTGGCGTCCGGCCGGATCGCGTACACCTTCGGGCTCGAAGGCCCGGCGATG
ACCGTGGACACGGCGTGCTCGTCGTCCCTGGTGGCCCTGCACCTGGCCATGCAGGCGCTG
CGCAACGGCGAGTGCGACCTCGCCCTCGCCGGCGGCGCCACCATCATGGCCACCCCCGGC
ACCTTCCAGGTCTTCTCCCGGCAACGCGGCCTGGCCGCCGACGGCCGCTGCAAGCCCTTC
GCCGACGCCGCCGACGGCACCGGCTGGGGCGAAGGCGCGGGCCTCCTGCTGCTCGAACGG
CTCTCGGACGCGGAGCGCAACGGCCACCGGGTCCTGGCGGTGCTGAAGGGTTCCGCGATC
AACCAGGACGGCGCGTCCAACGGCCTGACCGCTCCCAACGGCCCGTCGCAGCAGCGGGTC
ATCGAACAGGCGCTGGCCAACTCGGGCCTGACCGCGGAGCAGATCGACGTGGTCGAGGCG
CACGGCACGGGTACGACGCTGGGCGACCCCATCGAGGCGCAGGCGCTCCTCGCCACGTAC
GGCCAGGCGCACACCGAGGAGCAGCCGCTGTGGCTGGGCTCCATCAAGTCCAACATCGGC
CACACGCAGGCCGCTTCCGGGGTCGCGGGCGTCATCAAGATGGTCGAGGCCCTGCGGCAC
GGCCGGCTCCCGCAGACCCTGAACGTGGATCGGCCCTCGACCCACGTGGAGTGGGACACC
GGCCACGTGTCGCTGCTGACGGAGACGCAGGAGTGGCCGGAGACGGGCCGGCCGAGGCGT
GCGGCGGTGTCGTCGTTCGGCATGAGCGGCACCAACGCGCACCTGATCCTGGAAGCGGCC
TCGGCCCGGCCCGCGTCGGGCGAGGCTGCGGACGGGGACGAGCCCGGCTCCGGTGCCGCG
GTGCCGGTGGTGGTTTCCGCACGTACGGCGGGCGCGCTGGCGCAGGCTGCCGAGCAGCTC
GCGGAGTACGTGGAGCAGCACCCGGAGATCGAAGTGGGTCCGCTGGCCGCGCGGTTGTGG
TCCGGTCGGGCGAAGATGGAGCACCGCGCGGGCGTGGTCACGGCCGATCGAGACGAGTTG
CTGGAGGCGCTGACCGCGCTGGCCACCGGTTCCGCGCATGCGGCGCTGGTCACGGGCCCG
GGATCGGTGTCTGCCGGGAAGACCGCGTTCGTGTTCCCGGGCCAGGGTTCGCAGTGGACC
CGTATGGGCTACGACCTCGCCGCCGAAGAGCCCGCGTTCGCGGCGCACCTGGCCGCGTGC
CGCGATGAATTGTCACGTTGGTGCGACTGGGACCTCCTCGAAGTCCTCGCCAGCGAAGAC
GAGGACGCGCTCGACCGTGTTGACGTCGTGCAGCCCGCACTGTTCGCCGTCATGACCGGC
ATCGCCCAGCTCCTGCGCCACCACGGCGTCGAACCCGACGCGGTCATCGGCCACTCCCAG
GGCGAGATCGCCGCCGCCTACGTCGCCGGCGCGCTGACGCTGCCTGACGCCGTCGCCGTC
GTGGCGCTGCGGGCCCAGGCCATCACCCGCCTCGCCGGCACCGGGACCATGGCCTCCTTC
CCCCTCCCCCAGGACGAGTTGGGCGACCTGCCCGAGGGGGTGTACGTGGCCGCGGTCAAC
GGCCCGCACACGACGATCCTCGCCGGGGAAACGCAGCCCCTCGCCGACCTGGTCAGCAGC
TACCAGGAACGGGAGATCCGGGCGCGGCTGATCCCCGTCGACTACGCCTCGCACACCCCC
CACGTCGAAGACCTTCGGGAAACGATCATCACGGACCTGGCCGAGCGCGCCGGCATCGAA
CCGATGCCGCCGACAATCCCGTTCTACTCCACCCACACCGGCGCCCTCCTCGCGGAAGAC
CGGCTGCTGGACGCGGAGTACTGGTTCGACAACCTCCGCCACCCTGTCCACTTCCACACC
ACCCTCGAACAACTCCTCGACGACGGCCACCACACCCTCATCGAGTCCAGCCCCCACCCG
GTCATGACCGCCGCGCTGGCCGACACCTTCGAACAGCACGCCACCCCCGCCCACCACCAC
GCCACCCTCATCCGCAACAACGGCACCCAAACCCGCTTCCTCACCGCCCTCACCACCCTC
CACACCCACCACCACCCCATCGACCTCACCCCCCACCTCCCCGCCGCCGGCCTCTCCGGC
GACGAGTTGCCCGAGCTGCCCACCTACCCCTTCCAGCGCGACAGCTACTGGATCCAGTCC
TCGGCGCAGCTCACCAGTGCCACCGACCTCGGTCAGATCAGCAGCGCCCACGCGCTCCTC
AGCGCCGCCGTGCAGCTCGCCGACGGCAACGAGGACTCGGGCGACGGCACGCGGGGCGCG
TACACGACCACCGTGTTCACCGGCCGGGTCAGCCTGGGCACCCACTCCTGGCTCGCCGAC
CACGCCGTCGCGGGTACGGTCCTGCTGCCCGGCACCGCCCTCATCGACCTCGCCCTGCAC
GCAGGCGACCACACCGGCGCCACCCACCTCGAAGAGCTGACCCTCCAGGCGCCCCTGCTC
CTGGACGAGGCCGCCCGCGACCTCCAGGTCACCACGAGCCCCGAGGCGGGCGCCGAGGAC
GGCGGTCCCGTCCGCCGACAGGTCACCATCCATTCCCGGCCCCACACCGACGACGCCGAG
CCCGAGCCGTGGACCTGCCACGCCACCGGCACGCTGACCGCCGAACCGGCGGAGGCGGCC
CAGCCGCTCACCCAGTGGCCGCCCACCGGTGCACAGCGGCTCGACACCACCGGCCTCTAC
GCCCGGATGGCGGCTGCCGGCTACGAGTACGGGCCCGCGTTCCAGGGCGTGACCGCCGCC
TGGGCGCACCCCGACGGCAGCCTCCACGCCGAGATCGGCCTCGCCGAGGACGCCGACACC
GCGGGCCACACCATCCACCCCGCGCTGCTCGACGCCACCCTCCACCCGCTCGCCACCCGC
AGTCTTGACGAGGACGGTGACGCCGCGCAGGAGCTGCGGCTGCCGTTCGCGTGGAGCGGT
GTGTCCGTGCACGCCACCGGCGCCACCCACCTGCGCGCGACGATCACGCCCACCGGCGAA
CACGGCCACGACCTCACCCTCCACGCCTGGGACCCCACCGGCGCCCCCGTCGCCACCATC
ACCGCCCTCAACACCCGCCCCATCGACCCCGGTGCGCTGACCGGCAACGCCCGCACGGGA
GCCGCGACGCGCAACAGCCTCTTCCACGTGGCTTGGAGCCCGGCCCCCGCCGAGCCGGTG
GAGCAGGTGGATCTCGACCAGGTCGACGTGTACGTCGCCGTACCGGCCGCCGAGGACACC
CCGGCCGCGGCGCACGTGGCGACCGAGGCGCTGCTGACTCACGTACAGAACTGGCTGGCC
GACAACGACCAGAGCGACCGGCAGCTCGTCGTCCTCACCCACCGCGCCGTCGCCACCGAC
GCGGCCGAGGACGTGCACCTGGCGCACGCGCCGCTGTGGGGCCTGGTCCGTACCGCCCAG
AACGAACAGCCCGACCGCATCCGCCTCATCGACACCGACGCCGCCGGCATCAGGGGCAAC
GCGGCCGACATCCCGCAGCTCGCCGAGGCCCTGGCGACCGGCGAACCCCAACTCGCCCTG
CGCGACGGCCGGGTGCTCACCCCGCGCCTGACGCGGTCCACCGCCACCGACGCCGCCGCC
CGGCCCCTCGACCCCGAGGGCACTGTCCTGATCACCGGCGGCACCGGCGGCCTGGCGAGC
CTGACGGCCCGTCACCTGATCACCGAACACGGCGTACGCCACCTTCTTCTGGCCTCACGC
AGCGGCCCGGACCACCCGAACGCCCCCGCGCTCACCGACGAACTCACCGCACTCGGCGCG
CAGGTCACTGTCACCGCCTGCGACACCACCGACGCGGACCAGGTCACCGCCCTGATCGCG
GCCATCGACGGCGACCACCCCCTCACCGCCGTCATCCACACCGCCGGGGCCCTGAACGAC
GCCACTCTCGCCAAGCTCACTCCCGACGAGTTGCACCCGGTGCTGGCGCCGAAGGTGGAC
GCCGCGTACCACCTCCACCAGGCCACCAAGCACCTGGACCTCGCCCACTTCGTCCTCTAC
TCGTCGGCCGCCGGCACGCTGGGCAACCCCGGGCAGGCCAACTACGCCGCGGCCAACACG
TACGTGGACGCCCTCGCCCACGACCGCACCCGGCAGGGGCTCCCCACGACCAGCCTCGCC
TGGGGCTACTGGGAGCAGGCCACCGGTCTGACGAGCCACCTCAGCGACAACGAGGTCCGC
AACGTCACCCACGGCACGACCGCACTCACCGCCGAGCACGCCCTCCACCTGCTCGACACC
GCCCTGACCACCCCCCAGCCCCACCACCTCTGCGTCCCGGTCACGCCGTCCGCCCTGCGG
AACCCGGACCGGCTCCCCGTCCTCTTCCGCGGCCTCGCGTCCCGTCCGGCCCGGCGCGCC
GCGGCCGGCTCCGCCGCGGGCGACGGCAACGCACTGGCGGAGCGGCTCGCCGCGCTCTCC
GAGCCGGAGCAGCAGCACAAGGTCGTCCTGGACGTCGTACGGAGCAACATCGCCGCCGTC
CTCGGCCACGGCACCGCCGACACCATCGACCCCCACCGCCCCTTCAAAGAACTCGGCTTC
GACTCCCTCACCGCCGTCCAACTCCGCAACCAACTCACCACCACCACCGCACTACGCCTC
CCCGCAACCCTGATCTTCGACCACCCCACCCCCGAGGCCCTCACCCGTCACCTCCTGGGC
CGGCTCCTCGACTCGGCACCCGCCCGCGCCCGTACGGTCACCACGCGGACCGTCACCGAC
GACGACCCGATCGCCATCGTCTCGATGGCCTGCCGCTATCCCGGCGAGGTCCGCTCCGCG
GACGACCTGTGGCGGCTGGTCGCCGACGGCACGGACGCGGTCTCGGAGTTCCCGGTCAAC
CGCGGCTGGGACCTCGACAACCTGTACGACCCGGACCCGGACGCGACGGGCAGGACGTAC
ACGCGCCACGGCGCCTTCCTGCACGACGCGGACCGGTTCGACGCCGACTTCTTCCACATG
AACCCGCGCGAGGCCCTCGCCACGGACCCCCAGCAGCGGCTGCTGCTGGAAACCGCCTGG
GAGGCCTTCGAGCAGGCCGGCATCGACCCGGCCGGGCTGCGGGACAGCAACACCGGCGTG
TTCACAGGCGTCATCTACGCGGACTACGGCCCGCGTCTGATGCACCGGACCCCCGAGGGC
TTCGAGGGCTACCTCGGCAACGGCAGCGCCGCGAGTGTGGCGTCCGGCCGGGTGGCGTAC
ACCTTCGGCCTCGAAGGCCCGGCCATGACCGTCGACACCGCCTGCTCGTCGTCCCTCGTG
GGCATGCATCTCGCCGCGCAGGCGCTGCGCAACGGGGAGTGCGACCTCGCCCTCGCCGGC
GGCGTCACGGTGATGTCCACGCCCTCCGCGTTCCTCGAGTTCTCCCGCCAGCGCGGCCTG
GCCGCCGACGGCCGCTGCAAGCCCTTCGCCGACGCCGCCGACGGCACGGGCTGGGGCGAG
GGCGCAGGGCTCGTACTGCTGGAGCGCCTCTCCGACGCCCGGCGCAACGGACACGAGGTC
CTCGCCATCCTGCGCGGTTCGGCCGTCAACCAGGACGGCGCCTCCAACGGCCTCACGGCC
CCCAACGGCCCGTCGCAGCAGCGCGTCATCGAACAGGCCCTCGCCAACGCCGGGTTGAGT
GCGGGTCAGGTCGACGCGGTCGAGGCGCACGGTACGGGGACGACGCTGGGCGACCCGATC
GAGGCGCAGGCACTGCTGGCCACCTATGGTCAGGCGCACACCGAGGAGCAGCCCCTGTGG
CTGGGCTCCATCAAGTCCAACATCGGGCACACGCAGGCCGCGGCGGGGGTCGCGGGTGTG
ATCAAGATGGTCGAGGCCCTCCGCCACGGACACCTCCCCCAGACGCTCCATGTCGACGAG
CCCTCCACCCACGTGGAGTGGGACACCGGCCACGTCGCCCTCCTCACCGAGGGGCAGCCC
TGGCCGGAGACGGGCGAGGCGCGGCGCGCGGCGGTGTCCTCGTTCGGGATCAGCGGCACG
AACGCGCACGTGATCCTTGAGGCGGCCCCGGAGCCTGGTAAGCCGGTCGAGGAGCGGGTC
GACAAGTCGATGCCGGTGCCGGTGGTGGTCTCGGCCCGTTCGACTGCCGCGCTCGCCGAA
TCCGCGGGTCGGCTGGCGGCGTACGTCGAGCACCACCCCGACGTCGAGATCGGCGCGCTG
GCGGCACGGCTGTGGTCCGGGCGCGCCAAGCTGGAGCACCGCGCGGGCGTCATCACCTCC
GACCGCACGGAACTCCACGAAGCCCTCACCGCACTCGCCGCCGGCACCACGCACCCCGCG
CTGGTCACCGGCCCCGGCTCCGCCGAGACCGGAGGCCGCCTCGCGGTGATGTTCTCCGGA
CAGGGCAGCCAACGCCCCGGCATGGGCCGCGACCTGTACGAGACCATCCCCGCCTACGCC
GAAGCCCTGGACGAGGTCTGCACGGCCCTCGATGAGCATCTGGCGACGGGGACTTCGCTG
CGTGAGGTGATGTTCGCCGAACCCGGCAGCGAGCACGCCGCACTGCTGGAGACGACGCTC
TACACCCAGCCAGCCTTGTTCGCCCACCACGTGGCCGGCTACCGCCTGCTCCAAAAGGCA
GGCGTTCAGCCCGCCGCGCTCATCGGCCACTCCATCGGCGAACTCTCCGCCGCCCACCTC
ACCGGCGTACTTCCCCTCGCCGTGGCCGCCGACATGGTCGCCACCCGCGCCAAGCTGCTC
CACACCCTCCCCGACGGCACCGGCATGCTCGCCGTGCAGTCCGCACCCGAGCCCCTGACC
GAGTACCTCGACCGGCACGCGCAGGTGGAGATCGCCGCGTACAACTCCGAGGTCTCCACC
GCTCTCGCCGGACCTCTCGACGCCCTCGATGAGCTGGGCCGGGAGCTGACCGAGGCGGGC
ATCCGCACCAAGACGCTGAAGGTCGCACACGCCTTCCACACCGCACACACCGAGCCCATC
CTCGACACCTTCACCAACCACCTGACGGACCTCTTCAACCGCCACACCCTCGGCGACGCC
GACATCCCCGTCATCTCCAACATCACCGGACAGCCCGCCACCAGCGGACAGCACCACGAC
CCCGCCTACTGGGCCCAGCACATCCGCCAACCCGTCCACTTCCACCAAGGCATCACCCAC
CTCACCACCGACAGCGTCAGCCTCTTCACCGAGGTCGCCCCGCATCCCACCCTTGCCGCC
CACCTGCCGGTCGGCGTCCGCAGCACCCCCCACCTGCCGGACGAGACCCGCACCCACCTC
GCCGCACTGACCGCCCTCCACGCCCACCACCACCCCGCCGACCTCGCCCTCCGCCTCCCC
CGGTCCGGCGGCGGGCTGCCGAGCCTGCCCACCTACCCCTTCCAGAGCCTGCCCTACTGG
CTCGACCTCCCCGCTCAGGTCACCAGCGCCACCGACCTCGGCCAGGCGACGACCACGCAC
CCGCTGCTGCACGCCGCCGTCCAACTCGCCGACGGCGTCGACGAGAGCGCCGCGACCACG
GTGTTCACCGGCCGCGTGAGTCTGAAGACCCACCCCTGGCTGGCGGACCACGCCGTCGCT
GGTACGGTCCTGCTGCCCGGCACCGCCCTCGTCGACCTCGCGCTCCACGCGGGCGACCAC
ACCGGCGCCACCCACCTCGAAGAGCTGACCCTCCACGCGCCCCTGACCCTCGACGAGGCC
GGCACCCACGACCTTCAGGTCACCGCCTCCGTCCGGGGCGGGAGCGACGACGAGGGCGAA
GGCGCCGGCCGGTGGCAGGTGACGGTCCACTCCCGCCGCACCTCCGACAACGCCGAGCCG
GAGCCCTGGACCCACCACGCCACCGGCGCCCTCACCACCGAACCGGCCGAGCAGGCCGCG
CCGCTGGCGCAGTGGCCGCCCACGGGGGCGGAGCCCGTGGAGGTCACCGACCTCTACCCC
CGCCTGCTCGCGGCGGGCTACGAGTACGGGCCCGCCTTCCAGGGCGTCACCGCCGCCTGG
GCACACCCTGACGGCACCCTCCACGCCGAGATCAGCCTCGCCGAGGACACCGACGTCACG
GGCCACGCCATCCATCCCGCGCTGCTCGACGCCGCCATCCACCCGCTCGCCACCCGCACG
CTCCTCGCGGACAGCAAGGCGGCGGAACTGCGGCTGCCGTTCGCGTGGACCGGCGTCACC
GTCCACGCAACGGGCGCCACCGAGCTACGCGCCACGCTCACCCCCACCGGCGAACACGGC
CACGACCTCGCCCTGCGGACGTGGGACACGACGGGCGCACCGGTGGCGACGATCACCGCC
CTCAACACCCGACCCGTCGACGCCACCGCGCTCGCCGGCGCCCCCCACGCGAACACGGCC
ACTCGCAACAGCCTGTTCCACCTGGCGTGGCGCTCCGCCGCCACTCCGCAGGACCAGGCT
CAGGTGGATCTCGACCGGGTCGATGTGTACGCGGCCGCCCCGGCGGAGGACGACTCCCCC
GCCGCGGCCCACACCGCCACCGAGGCACTGCTCACCCACCTCCAGAGCTGGCTGGCCAAG
AACGACGCCACCGACCGACAGCTCGTCGTCCTCACCCACCGCGCCGTCGCCACCGGCCCG
GCAGAGGACGTGCACCTGGCGCACGCGCCACTGTGGGGCCTGGTCCGTACCGCCCAGAAC
GAGAACCCCGACCGCATCCACCTCATCGACACCGACACCGACAACACCCCAGACCTCACC
GCAGCCCTCGCCACCGGCGAACCCCAACTCGCCCTCCGCAACGGCGACATCCTCATCCCC
CGCCTCACCCGCTCCACCGACAGCGCAGCGACCGAACCCCGCCCCCTCGACCCCGACGGC
ACCGTCCTCATCACCGGCGGCACCGGCGGCCTGGCGAGCCTCACCGCCCGCCACCTCATC
ACCGAACACGGCGTACGCCACCTGCACCTGGCCTCACGCAGCGGCCCCGACCACCCCAAC
GCCCCCGCGCTCACCGACGAACTCACCGCACTCGGCGCGCAGGTCACCCTCACCGCCTGC
GACACCACCGACGCGGACCAGGTCACCGCCCTGATCGCGGCCATCGACGGCGACCACCCC
CTCACCGCAGTCATCCACACCGCGGGCGTCCTCAACGACGCCGTCCTGGGCAAGCTGACC
GCCGACGGCCTCCACTCCGTTCTTGCGCCGAAGGTGGACGCCGCGTACCACCTCCACCGC
GCGACCATGGGCCTGGACCTCGCCCACTTCGTCGTCTACTCGTCGGCCGCCGGCATCCTC
GGCAACCCCGGCCAGGCGAACTACGCCGCCGCCAACACCTACCTCGACGCACTCGCCCAC
CACCGCACCCGGCAGGGCCTGCCCACCACCAGCCTCGCCTGGGGCTACTGGAAGCAAGCC
ACGGGTCTGACCAGCCACCTCAGCGACAACGAGGTCCGCAACGTCACCCACGGCACCACG
CCCCTCACCACGGACCACGCCCTGCACCTCCTCGACACCGCCCTCACCACCCCCCAGCCC
CACCACCTCTGCACCCCGCTCAACCCCAGCACCCTCCGCACCACACCCCACCTCCCCGCG
CTCCTCCGCGACCTCGTGCCCGCCCCCCGGCGCACCGCCGCGCGGGCGCACGGTGCGCAG
CCGTCGGGTGCGGACCTGGCCGACCGGCTCCGGGCGCTGCCGCCGGAGGGGCAGCAGAAG
CTGCTGCTGGACGTCGTGTGCAGCGCGGTCGCCGCGGTGCTCGGGCACGGCGGCGCGGAC
GCGATCGATCCGTACCGCCCGTTCAACGAGCTGGGCTTCGACTCCCTCACCGCCGTCCAG
CTCCGCAACCGCCTCACCGAGGCGACCGGGCTCCGCCTGACCTCCACGCTGATCTTCGAC
TACCCCACGCCGAACGACCTGGCGCGTTACGTCGGCGAGGGCATCGGTCCGGACGAGACG
AGCGTGGAGACCTCCTTCCTGGCGGAGATCGACAAGCTCGAACTGACCCTGATCGACCGT
TCCGCGGAGGACGCCGGGCGAGTGAAGGTGACGCGCCGACTCCAGGCCCTCCTCACCCGC
CTCAACGAGACCGCGGGCTCGGCGCCGGCCGGCGAGGACATCGAGACGAAGCTCCGTTCG
GCGTCCAACGACGAACTCTTCGACCTGCTCGACGGCGATCTCGACCTTTCCTGA
[6] KS34..409
[6] AT577..892
[6] methylmalonyl-CoA762..766
[6] DH944..1118
[6] ER1422..1726
[6] KR1736..1916
[6] ACP2017..2087
[7] KS2114..2490
[7] AT2650..2964
[7] methylmalonyl-CoA2835..2839
[7] DH3017..3197
[7] KR3487..3667
[7] ACP3769..3839
[8] KS3862..4239
[8] AT4398..4688
[8] malonyl-CoA4590..4594
[8] DH4760..4936
[8] KR5220..5400
[8] ACP5502..5572
[6] KS100..1227
[6] AT1729..2676
[6] methylmalonyl-CoA2284..2298
[6] DH2830..3354
[6] ER4264..5178
[6] KR5206..5748
[6] ACP6049..6261
[7] KS6340..7470
[7] AT7948..8892
[7] methylmalonyl-CoA8503..8517
[7] DH9049..9591
[7] KR10459..11001
[7] ACP11305..11517
[8] KS11584..12717
[8] AT13192..14064
[8] malonyl-CoA13768..13782
[8] DH14278..14808
[8] KR15658..16200
[8] ACP16504..16716

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [571-698]  G3DSA:3.40.366.10 [762-883]  G3DSA:3.40.366.10 [2644-2771]  G3DSA:3.40.366.10 [2835-2956]  G3DSA:3.40.366.10 [4388-4523]  G3DSA:3.40.366.10 [4590-4682]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2045-2060]  PS00012 [3797-3812]  PS00012 [5530-5545]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2010-2130]  2.70000183580794e-26 SSF47336 [3762-3878]  4.19999771339581e-28 SSF47336 [5493-5579]  1.99999636034521e-22 SSF47336
SSF47336   ACP_like
 [2020-2086]  6.3e-12 PF00550 [3772-3838]  3.2e-12 PF00550 [5505-5571]  4.6e-13 PF00550
PF00550   PP-binding
 [2017-2087]  PS50075 [3769-3839]  PS50075 [5502-5572]  PS50075
PS50075   ACP_DOMAIN
 [2016-2089]  1.60000000000002e-67 G3DSA:1.10.1200.10 [3770-3842]  1.60000000000002e-67 G3DSA:1.10.1200.10 [5500-5573]  1.60000000000002e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1410-1556]  1.60000240695997e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1560-1656]  1.4e-14 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1442-1498]  7.59999999999999e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1736-1915]  1.6e-64 PF08659 [3487-3666]  2.99999999999998e-62 PF08659 [5220-5399]  1.09999999999999e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  3.90000000000001e-95 PF00109 [2114-2364]  9.60000000000004e-95 PF00109 [3862-4113]  4.09999999999995e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  1.29999999999998e-48 PF02801 [2372-2490]  4.5e-47 PF02801 [4121-4239]  2.99999999999998e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [577-892]  7.79999999999999e-89 PF00698 [2650-2964]  3.39999999999996e-90 PF00698 [4398-4688]  2.89999999999999e-56 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-875]  2.69998997787809e-64 SSF52151 [2647-2948]  1.10000150671643e-64 SSF52151 [4393-4704]  7.20002719778969e-56 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [700-761]  2.49999811956465e-11 SSF55048 [2773-2834]  3.00000067992871e-11 SSF55048 [4525-4589]  1.39999892049878e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-293]  G3DSA:3.40.47.10 [295-460]  G3DSA:3.40.47.10 [2116-2376]  G3DSA:3.40.47.10 [2377-2541]  G3DSA:3.40.47.10 [3864-4125]  G3DSA:3.40.47.10 [4126-4291]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-407]  3.19999899046355e-103 SSF53901 [2106-2486]  7.80005155399507e-103 SSF53901 [3854-4291]  1e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1513-1701]  1.6e-48 G3DSA:3.40.50.720 [1736-1932]  1.10000000000001e-112 G3DSA:3.40.50.720 [3487-3670]  1.10000000000001e-112 G3DSA:3.40.50.720 [3754-3769]  1.10000000000001e-112 G3DSA:3.40.50.720 [5220-5434]  1.10000000000001e-112 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [2277-2293]  PS00606 [4026-4042]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [578-874]  1.50000965748778e-95 SM00827 [2651-2947]  6.29998179434741e-97 SM00827 [4397-4710]  4.50001022902825e-82 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2018-2090]  3.89999861795218e-35 SM00823 [3770-3842]  3.10001307370206e-35 SM00823 [5503-5575]  6.39998633403535e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [944-1118]  3.60002015031011e-79 SM00826 [3017-3197]  8.39998014024973e-72 SM00826 [4760-4936]  2.19999900980707e-74 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  SM00825 [2116-2542]  SM00825 [3864-4291]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1736-1916]  1.39999277195148e-65 SM00822 [3487-3667]  1.99999636034521e-61 SM00822 [5220-5400]  6.29998179434732e-59 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1422-1726]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit