close all open/close all

CDS information : Tetrn_00170


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction64,292 / 82,183 / + [in whole cluster]
64,292 / 82,183 / + [in contig]
Location64292..82183 [in whole cluster]
64292..82183 [in contig]
TypeCDS
Length17,892 bp (5,963 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)tmnAV
EC number
Keyword
Note
Note (GenBank)
  • module 9 (KS, AT-A, DH, ER, KR, and ACP); module 10 (KS, AT-P, DH, ER, KR, and ACP); module 11 (KS, AT-P, DH, KR, and ACP)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

9 malonyl-CoA
10 methylmalonyl-CoA
11 methylmalonyl-CoA
KS34..411
AT569..866
DH931..1111
ER1417..1721
KR1731..1911
ACP2009..2079
KS2102..2478
AT2641..2955
DH3008..3179
ER3483..3787
KR3797..3977
ACP4077..4147
KS4170..4546
AT4702..5016
DH5066..5240
KR5518..5698
ACP5799..5869

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MSDEAKLREYLTRAVAELHQTRQRLQDAETARQEPIAIVSMACRYPGGVRSPEDLWQLVA
DGTDAISGFPGNRGWDVEGLYDPDPDRTGKSYSREGGFLHSADEFDAEFFGMSPREATAT
DPQQRLLLEAAWETFERAGIDSHSLKGSKTGVFAGVMYDDYTGRLMHRIPEGYEGFLGNG
GAASVASGRVAYTFGLEGPAVTVDTACSSSLVSMHLAAQALRNEECDLALAGGVTVMATP
GVFVEFSRQRGLAPDGRCKPFAEAADGTGWGEGVGFVLLERLSDAERNGHEILAVLRGSA
VNQDGASNGLTAPNGPSQQRVIEQALASARLSAGQVDAVEAHGTGTTLGDPIEAQALLAT
YGQAHSAERPLWLGAVKSNIGHTQAAAGVAGVIKMVEAMRHGVLPRTLHVDEPSTHVDWN
TGHVALLTEAQQWPETGEPRRSAVSSFGISGTNAHVILEAAPEQSAEADATTEPSPVPVV
VSARSTAALAEAAARLAAYVEQHPDVEVAALAARLWSGRAKLEHRAGVITADRTELHEAL
TALAAGTTHPALVTGPGSAETGGRLAVMFSGQGSQRPGMGRDLYETFPAYAEALDEVCAA
LDQHLDTEVPLRDVMFAEPGSEHAALLETTLYTQPALFAHHVAGYRLLEKVGVQPAALIG
HSIGELSAAHLTGTLPLAVAADMVATRAKLLHTLPDGTGMLAVNTDADTLTPYLKRHPSV
AVAAHNSEVSTALAGPLDALEELGRELTEAGIRTKALKVAHAFHTAHTEPILGAFTGHLT
DLFNRHTLGDADIPVISNITGQPATSGQHHDPEYWAQHIRQPVHFHQGITHLTDDGISLF
TELAPHPTLTPHLPGGARSTPHLPAETLTHLAVLTALHAHHHPADLAPHLPETAARVPVL
PTYPFQHRPFWLDAPAALTSATDLGQLGTAHALLGAAVQLADTTGSGAGSAGTTVFTGRV
GLNTHPWLADHAVAGTVLLPGTALVDLALHAGDHTGATHLQELTLHAPLVLDGAGTHDVQ
VTTAPQPGPEGEDAGRWQVTIHSRRHTADDAEPEPWTCHATGILTADDPAAGTAPALAQW
PPSGAEPVEVADLYPRLLAAGYEYGPAFQGVTAAWRGADGALHAEIALPEDTDAAGHTIH
PALLDAALHPLAAEKVGKDDADGRLRLPFAWTGVTVHATGATHLRATLIPTGEHGHDLTL
HTWDPSGAPVATVTALNSRAVDASALTGAAHAGAATRNSLFHLVWNATAAEPQERAGLVA
PELVDLYVAAPAEEDGPVAAHAAAEALLAHVQGWLAANDRTDRRLAVLTHRAVATNPADD
LHLPHAPLWGMVRTAQNENPDRIHLVDTDTATDAVTGGDPAAVPHLLDALATGEPQLAVR
HDQVLAPRLARSADGAADALSIPAGEQSWRLDKTASGTFDNLALLPNPHLPEELAPHQVR
VAVRAIGLNFRDVLITLGMYPGEALLASEGAGVVTEVGADVGNVAVGDRVMGMFPNGVGA
QTVTDHRMVTAIPERWSFTDAAGIPVAYLTAYYGLKDLGGLEAGESLLLHAATGGVGSAA
LQLARHWGAEVYATASPGKHHLLYAQGLDQNHIASSRSLDFEEHIRTHAPDQGVDVVLNA
LAHEFTDASLRLLRPGGRFLEMGKTDIRDPQAVEAEHQVRYQNFDLIEAGPDRIQEMLVH
LAELFAEGRLTPPRTTCFDVRHAPHALRHLSQARHTGKLILTLPRPLDPDGTVLITGGTG
GLAGLTARHLVTEHGVRHLHLASRSGPDHPNAAALSEELGALGAQVTITACDTTDPEAVH
RLVASVDEQHPLTAVIHTPGVLDDTILTQLTPETLHPVLAPKVDAAYHLHQATRHLDLAH
FVLYSSAAGTLGNPGQANYAAANTYLDALAHHRTRQGLPTTSLAWGYWKHTTDLTSHLGD
SEVARSDAALSTEHGLQLLDAALATPSPYHLCVPLNPATLRTGDRVPALLRDLAPRARRR
AAAAVAAGEVSGLAQQLAGLSAADQQRLLLDLVRTNAAAVLGHSDAAAVDAQAPFNDLGF
DSLTAVELRNRLDSATGLRLPATLIFDYPTAQVLAEHIGAELLESAPRSAAPQLVSADAA
DDPVVIVSMACRFPGDVRSAAGLWKLVTEGREGVSGFPTNRGWDLDNLFDPDPAATGKSY
TSYGTFLHEADEFDADFFRMNPREALATDPQQRLLLETSWEAFERAGIDPGTLRGSSTAV
YAGVIYGDYGSRLMQNAPEGFEGYLGNGSAASVASGRVAYTFGLEGPAVTVDTACSSSLV
ALHLAAQALRNGECDLALAGGVTVMSSPGAFIEFSRQRVLSVDGRCKAFAEAADGTGWGE
GVGLVLLERLSDAQRNGHTVLAVLKGSAINQDGASNGLTAPNGPSQQRVIEQALASAGLT
PGQVDAVEAHGTGTALGDPIEAQALLATYGREHSPERPLWLGSIKSNIGHTQAAAGVAGV
IKMVEAMRHGTLPPTLHVNEPSQHVDWSSGTISLITESTPWPESDEPHRAAVSSFGISGT
NAHVVLEAAPVEPAAAEPTAERVPDKSRAAPVPVVVSARTADALAQAAGQLAEFVERHPQ
VEVGALASGLWSGRAKMEHRAGVVTADRDELLEALTALATGSAHAALVTGPGSVSAGKTA
FVFPGQGSQWTRMGYELAAQEPAFAAHLASCRDELSRWCDWDLLEVLASEDEHALDRVDV
VQPALFAVMTGIAQLLRHHGVEPDAVIGHSQGEIAAAYVAGALTLSDAVAVVALRAQAIT
RLAGTGTMASFPLPQDELVDLPEGVYVAAVNGPHTTILAGETQPLADLVNNYQEREIRAR
LIPVDYASHTPHVEDLRETIITDLAERAGIEPMPPTIPFYSTHTGALLTFDQDLDAEYWF
NNLRHPVHFHTTLEQLLDDGHYTLIESSPHPVMTAALADTFEQRATPARHYATLVRNDDT
KVRFLTALTTLHTHHHPIDLTPHLPAADRSGDGLPELPTYPFQRESYWLHGSAQLTSASD
LGLGTTAHPLLHAAVQLADEAGTGAAGAVVFTGRVGLSTHSWLADHAVAGTVLLPGTALV
DLALHTGDHTGATHLEELTLQAPLVLQESGARDLQVTASPHPEADGWQVTIHSRPHTDDE
AEPEPWTCHATGTLTAEPAVKAEALDQWPPAGAQALDVSEIYPRLAAGGYEYGPAFRGVT
AAWAQPDGTLHAEIALPEDTDPDGHTIHPALLDAALHPLAAHGGAGGKADAAEDAQVRLP
FAWTGVSVHATGATHLRATITPTGAEGHDLALRAWDPTGAPVATIGALNTRAVAASALTG
GADAGAATRNSLFHLSWSPAQAEQEEQEELDRYDVHVAAPAAEDTPAAAHAATEALLVHV
QNWLAANDQTDRLLAVVTHRAVATHPAEDVHLAHAPLWGLLRSAQSENPDRIHLVDTDAT
GIAPDADAADIPYLADALATGEPQVAVRGGQVLAARLVRAAGAESGVLDVPEGTWKLGNE
GDGTLEALACRPAPEWDVPLTGSQVRVQLHAVGLNFRDTLIALGMYPGDAPLGSEGAGVV
TEIGADVTNVAVGDRVMGLMPEGAGSRAITDHRLLTPVPAEWSSTQAAGTPVAFLTAYYA
LKDLGRLEAGESLLLHAATGGVGSAALQLARHWGAEVYATASPGKHHLLYAQGLDDAHIA
SSRSLDFEEHFRTHGPDQGVDVVLNALAHEFTDASLRLMRPGGRFIEMGKTDIRDPQAVE
AEHGALYRNFDLIEAGPDRIRQILAHLTELFAEGHLTPLPTTSFDVRQARQALRYLSQAR
HTGKVILDLPRALDPDGTVLITGGTGVLAGLTARHLITEHGVRHLLLASRSGPDHAGAAA
LSEELTALGAQITVTACDVTDPDAVHALVDSVDEHHPLTAVIHTAGALNDAVLTKITPAD
LHPVLAPKVDAAYHLHQATRHLPLARFVVYSSAAGTLGNPGQANYAAANTYLDALAHHRT
RQGLPTTSLAWGYWKQATGLTAHLTADQQGRTGTALTTEHGLRLFDVALRDRPESTLVCM
PIEPGGLRRAAKVPALLRDLVPATARRATAAGASAVRRSGLAEELAGLGEAEQDRLVLDL
IRSNVAAVLGHARPETIDPQRPFKELGFDSLTAVELRNRLTNATALQLPSTLVFDHPTLT
ELSVFLRGKLLDEQPRVRAAKQVATVVDDDPIAIVSMACRYPGGMRRPEDLWKLVSEGVE
AIGDLPDDRGWDLDGLYDPDPDAPGKMYTRKGAFLYDAGQFDADFFHMNPREALATDPQQ
RLLLETAWEAFERAGIDPTSLKGSSTGVFAGVISQDYLMRMHDAPDHLEGYFATGGSASI
ASGRVAYTFGLEGPAMTVDTACSSSLVALHLAAQALRNGECDLALAGGATIMATPGTFQV
FSRQRGLAADGRCKPFADAADGTGWGEGVGLVLVERLSDARRNGHEVLAVVRGSAINQDG
ASNGLTAPNGPSQRRVIEQALANAGLSGDQVHAVEGHGTGTTLGDPIEAQALLETYGQAH
SEENPLWLGSIKSNIGHTQAAAGVAGVIKMVEAMRHGVLPPTLNVDAPTSHVDWAAGHIE
LLTEARPWTEEAGPRRAAVSSFGMSGTNAHLILEAAPAEADAEAEPEAGAPPVPVVVSAR
SAAALAQSAGRLAEYVEQHPEIEVGPLAARLWSGRAKMEHRAGVVTADRDELLEALTALA
TGAAHPALATGPGSAVAGKTAFVFPGQGSQWTRMGYDLAAEEPAFAAHLAACRDELSRWC
DWDLLEVLASEDEDALDRVDVVQPALFAVMTGIAQLLRHHGVEPDAVIGHSQGEIAAAYV
AGALTLSDAVAVVALRAQAITRLAGTGTMASFPLPQDELGDLPEGVYVAAVNGPHTTILA
GETQPLTDLVNTYQEQEIRARLIPVDYASHTPHVEDLRETIITDLTERAAIEPVPPTIPF
YSTHTGAVLTFDQDLDAEYWFNNLRHPVHFHTTLEQLLDDGHHTLIESSPHPVMTAALAD
TFEQRTTPAHHHATLIRNNGTKARFLTALTTLHTHHHPIDLTPHLPAAGSTPAGLPTYPF
QHQPYWLNTPARLTSAGDLGLATTTHPLLHAAVQLADGADGGAGTTVFTGRVGLSTHPWL
ADHAVTGTVLLPGTGLVDLALHAGDHTGATHLEELTLQAPLVLEETGARDLQVTAAPQGG
SDAGGTGRWQVTIHSRPHTGDAEPEPWTCHATGTLTAEAAEAAEALTEWPPTGAEAFDVG
ALYPELAAAGYEYGPVFQGVTAAWKGSDGTLHAEIALPQGADAAGHTLHPALLDAALHPL
AAHNDGADGQMQLPFAWTGVTVHATGATELRATLTPTGEQGHDLALRTWDTTGAPVATIT
ALNTRPVDAAALSTRSSDDTRNSLFHLAWSPAPAEPATQVDLDQVDVYAAAPAEDDSPAA
AHTATEALLTHLQSWLAENDETDRRLVVLTHRAVATDAAEDVHLAHAPLWGLVRTAQNEQ
PDRIHLIDTDTDDTPDLTAALATGEPQLALRNGDILIPRLTRSTDDAGTEARPLNPDGTV
LITGGTGGLASLTARHLITEHGVRHLLLASRSGPDHPNAPALSSELTELGAQVTITACDV
TDDDAVRALVDSIDGDHPLTAVIHTAGALGDAVLSKLTPDDLHPVLAPKVDAAYHLHQAT
KHLDLAHFVLYSSAAGTLGNPGQANYAAANTYLDALAHHRTRQGLPTTSLAWGYWEQATG
LTGHLTASQQNRTGTPLTTDHALHLLDTALTTPQPHHLCTPLNPSTLRTTPHLPALLRDL
VHRPVRRTAAASAPGVPGGTALADQLAALPEPEQRHKVVLDVVRSNIAAVLGHGTADTID
PHRPFKELGFDSLTAVQLRNQLTTTTALRLPATLIFDHPTPDAMAARILADLMPEAVSPS
RRVIADLDALELELKQLAADEAERSRITLRLQTLLSNWNDARPVPAEDVSNKIQESSTEE
IFDFIDRQLGRTDGDEAPSAPAR
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGTCGGACGAAGCCAAGCTTCGGGAGTACCTGACCCGCGCAGTCGCCGAGCTGCACCAG
ACGCGGCAGCGCCTGCAGGACGCCGAGACGGCAAGGCAGGAGCCGATTGCGATCGTTTCG
ATGGCCTGCCGGTACCCGGGCGGGGTGCGCTCGCCCGAGGACCTGTGGCAGCTGGTCGCG
GACGGCACGGACGCGATCTCCGGCTTCCCCGGCAACCGCGGCTGGGACGTCGAGGGCCTC
TACGACCCGGATCCCGACCGGACCGGGAAGAGTTACTCGCGCGAGGGCGGCTTCCTGCAC
TCGGCGGACGAGTTCGACGCCGAGTTCTTCGGCATGAGCCCGCGGGAGGCCACGGCCACG
GACCCGCAGCAGCGGCTGCTGCTGGAGGCCGCCTGGGAGACGTTCGAGCGCGCGGGCATC
GACTCGCACTCCCTCAAGGGCAGCAAGACGGGCGTGTTCGCCGGGGTCATGTACGACGAC
TACACCGGCCGGCTCATGCACCGGATCCCGGAGGGCTACGAAGGCTTCCTGGGCAATGGT
GGTGCGGCGAGTGTGGCGTCGGGTCGGGTGGCGTACACCTTCGGTCTCGAAGGCCCCGCG
GTCACCGTCGACACCGCCTGCTCCTCGTCGCTGGTGAGCATGCACCTGGCTGCGCAGGCG
TTGCGCAACGAGGAGTGTGATCTTGCGCTTGCCGGTGGTGTGACGGTGATGGCCACTCCG
GGTGTGTTCGTGGAGTTCTCGCGGCAGCGTGGGTTGGCGCCTGATGGGCGGTGCAAGCCG
TTCGCGGAGGCTGCCGACGGTACGGGCTGGGGCGAGGGTGTCGGTTTCGTGCTGCTGGAG
CGGCTGTCGGACGCGGAGCGCAACGGGCACGAGATTCTGGCGGTGCTGCGGGGTTCGGCC
GTCAACCAGGACGGCGCTTCCAACGGTCTGACCGCGCCCAACGGCCCTTCCCAGCAGCGG
GTCATCGAACAGGCGTTGGCCAGTGCGCGGTTGAGTGCGGGTCAGGTCGATGCGGTCGAG
GCGCACGGTACGGGTACGACGCTGGGCGACCCGATCGAGGCACAGGCGCTGCTGGCCACC
TATGGTCAGGCGCATTCTGCGGAGCGGCCGTTGTGGCTGGGTGCGGTGAAGTCGAACATC
GGTCACACCCAGGCCGCGGCGGGTGTCGCGGGTGTGATCAAGATGGTCGAGGCCATGCGC
CACGGCGTCCTGCCCCGCACCCTCCACGTCGACGAACCCTCCACCCACGTCGACTGGAAC
ACCGGCCACGTCGCCCTCCTGACCGAAGCGCAACAGTGGCCCGAGACGGGTGAGCCGCGA
CGCTCAGCGGTGTCCTCCTTCGGGATCAGCGGCACCAACGCGCACGTCATCCTGGAGGCC
GCCCCGGAGCAGTCCGCGGAAGCCGACGCGACGACCGAGCCCTCTCCGGTGCCGGTGGTG
GTCTCGGCGCGTTCGACGGCGGCGCTGGCGGAGGCCGCTGCCCGGCTGGCGGCGTACGTC
GAGCAGCACCCCGACGTCGAGGTCGCCGCGCTGGCGGCACGGCTGTGGTCCGGGCGCGCG
AAGCTGGAGCACCGCGCGGGCGTGATCACCGCCGACCGCACCGAACTGCACGAAGCCCTC
ACCGCACTCGCCGCCGGCACCACGCACCCGGCGCTGGTCACCGGCCCCGGGTCCGCCGAG
ACCGGTGGGCGGCTTGCGGTGATGTTCTCCGGACAGGGCAGCCAACGCCCCGGCATGGGC
CGCGACCTGTACGAGACCTTCCCCGCCTACGCCGAAGCCCTGGACGAGGTCTGCGCCGCG
CTGGACCAGCACCTCGACACCGAGGTCCCACTACGGGACGTGATGTTCGCCGAACCCGGC
AGCGAGCACGCCGCGCTGCTGGAGACGACGCTCTACACCCAGCCCGCCCTCTTCGCCCAC
CACGTGGCCGGCTACCGCCTGCTCGAAAAGGTAGGCGTTCAGCCCGCGGCGCTCATCGGT
CACTCCATCGGCGAACTCTCGGCCGCCCACCTCACCGGCACCCTCCCCCTCGCCGTGGCC
GCCGACATGGTCGCCACCCGCGCCAAGCTGCTCCACACCCTCCCCGACGGCACCGGCATG
CTCGCCGTCAACACCGACGCCGACACCCTCACCCCGTACCTCAAGCGCCACCCCTCCGTG
GCCGTCGCCGCGCACAACTCCGAGGTCTCCACCGCCCTGGCCGGGCCCCTCGACGCCCTC
GAAGAGCTGGGCCGGGAGCTGACCGAGGCGGGGATCCGCACCAAGGCGCTGAAGGTCGCG
CACGCCTTCCACACCGCACACACCGAGCCCATCCTCGGCGCCTTCACCGGCCACCTGACG
GACCTCTTCAACCGCCACACCCTCGGCGACGCCGACATCCCCGTCATCTCCAACATCACC
GGACAGCCCGCCACCAGCGGGCAACACCACGACCCCGAATACTGGGCCCAGCACATCCGC
CAACCCGTCCACTTCCACCAAGGCATCACCCACCTCACCGACGACGGCATCAGCCTCTTC
ACCGAGCTGGCGCCCCACCCGACTCTCACCCCCCACCTCCCCGGCGGCGCCCGCAGCACC
CCCCACCTGCCGGCGGAAACCCTCACGCACCTCGCCGTGCTCACCGCCCTCCACGCCCAC
CACCACCCCGCCGACCTCGCCCCGCACCTCCCCGAGACCGCGGCCAGGGTCCCCGTTCTC
CCGACCTACCCGTTCCAGCACCGCCCCTTCTGGCTCGACGCCCCCGCCGCGCTCACCAGT
GCGACCGACCTCGGCCAGCTCGGAACCGCCCACGCCCTCCTCGGTGCCGCCGTCCAGCTC
GCGGACACCACCGGGAGCGGCGCCGGCTCCGCCGGCACGACGGTGTTCACCGGCCGGGTC
GGTCTCAACACCCACCCCTGGCTGGCCGATCACGCCGTCGCCGGTACGGTCCTGCTGCCC
GGCACCGCCCTCGTCGACCTCGCCCTCCACGCGGGCGACCACACCGGCGCCACCCACCTG
CAAGAGCTGACCCTCCACGCGCCGCTCGTCCTGGACGGGGCCGGCACCCACGACGTGCAG
GTCACCACCGCTCCCCAGCCCGGGCCGGAGGGCGAGGACGCGGGCCGGTGGCAGGTGACG
ATCCACTCCCGCCGCCACACCGCCGACGACGCCGAGCCGGAGCCCTGGACCTGCCACGCC
ACCGGCATCCTCACCGCCGACGACCCCGCTGCCGGCACGGCCCCGGCGCTGGCCCAGTGG
CCGCCGTCCGGTGCCGAGCCCGTGGAGGTCGCCGACCTCTACCCCCGGCTCCTCGCGGCG
GGTTACGAGTACGGGCCCGCGTTCCAGGGCGTCACCGCCGCCTGGCGCGGCGCCGACGGC
GCCCTCCACGCCGAGATCGCCCTCCCCGAGGACACCGACGCCGCCGGCCACACCATCCAC
CCCGCGCTCCTGGACGCGGCCCTCCACCCCCTCGCGGCCGAGAAGGTCGGCAAGGACGAC
GCGGACGGCCGGCTCCGGCTGCCCTTCGCGTGGACCGGCGTCACCGTCCACGCCACCGGC
GCCACCCATCTGCGCGCCACGCTCATCCCCACCGGCGAGCACGGCCACGACCTGACCCTG
CACACCTGGGACCCCTCGGGTGCGCCCGTCGCCACCGTCACCGCGCTCAACTCCCGTGCG
GTCGACGCCTCGGCGCTCACGGGCGCCGCCCACGCGGGCGCCGCGACGCGCAACAGCCTG
TTCCACCTCGTCTGGAACGCGACCGCAGCCGAGCCGCAGGAGCGGGCCGGGCTGGTGGCA
CCGGAGCTGGTGGACCTCTATGTCGCGGCTCCCGCCGAGGAGGACGGCCCCGTCGCCGCG
CACGCGGCGGCGGAGGCGCTGCTCGCCCACGTGCAGGGCTGGCTGGCCGCCAACGACCGG
ACGGACCGCCGCCTCGCCGTCCTCACGCACCGCGCAGTCGCCACCAACCCGGCCGACGAC
CTCCACCTGCCGCACGCGCCGCTGTGGGGGATGGTCCGTACCGCCCAGAACGAGAACCCG
GACCGCATCCACCTCGTCGACACGGACACCGCCACCGACGCGGTCACCGGCGGCGACCCC
GCCGCCGTCCCCCACCTGCTCGACGCCCTGGCCACCGGGGAGCCGCAGCTCGCCGTCCGC
CACGACCAGGTCCTCGCCCCCCGGCTCGCCCGCTCCGCCGACGGCGCCGCCGACGCGCTG
TCGATCCCCGCCGGCGAGCAGTCCTGGCGGCTGGACAAGACCGCGTCCGGCACGTTCGAC
AACCTGGCCCTCCTGCCCAATCCGCACCTCCCCGAGGAGCTGGCACCGCATCAGGTACGG
GTCGCGGTACGGGCCATCGGGCTCAACTTCCGCGACGTGCTGATCACCCTCGGCATGTAC
CCGGGCGAGGCGCTGCTCGCCAGCGAGGGCGCCGGTGTCGTGACCGAGGTCGGCGCCGAC
GTCGGGAACGTCGCCGTCGGCGACCGCGTCATGGGCATGTTCCCGAACGGCGTGGGCGCG
CAGACGGTCACCGACCACCGCATGGTCACCGCCATCCCCGAGCGGTGGTCCTTCACCGAC
GCGGCCGGGATCCCGGTGGCGTATCTCACCGCGTACTACGGGCTCAAGGACCTCGGCGGC
CTGGAGGCCGGCGAGTCGCTGCTGCTGCACGCCGCGACCGGCGGCGTCGGCTCCGCCGCA
CTCCAGCTCGCCCGCCACTGGGGCGCCGAGGTCTACGCGACCGCCAGCCCCGGCAAGCAC
CACCTGCTGTACGCGCAGGGGCTCGACCAAAACCACATCGCGTCCAGCCGGTCCCTGGAC
TTCGAGGAGCACATCCGCACCCACGCCCCCGACCAGGGTGTCGACGTGGTCCTCAACGCC
CTCGCCCACGAGTTCACCGACGCCTCCCTGCGCCTGCTGCGCCCCGGCGGCCGGTTCCTG
GAGATGGGCAAGACCGACATCCGTGACCCGCAGGCGGTCGAGGCCGAACACCAGGTCCGC
TACCAGAACTTCGACCTCATCGAGGCCGGCCCGGACCGCATCCAGGAGATGCTGGTCCAC
CTGGCCGAGCTGTTCGCCGAGGGCCGCCTCACGCCGCCGCGGACCACCTGCTTCGACGTA
CGGCACGCCCCGCACGCGCTGCGGCACCTGAGCCAGGCCCGGCACACGGGCAAGCTGATC
CTCACGCTGCCCCGGCCGCTCGACCCGGACGGCACCGTGCTCATCACGGGCGGCACCGGT
GGCCTGGCGGGCCTGACGGCCCGTCACCTGGTCACCGAGCACGGCGTACGCCACCTGCAC
CTGGCCTCGCGCAGCGGCCCGGACCACCCCAACGCGGCCGCCCTCAGCGAGGAACTCGGC
GCACTCGGCGCGCAGGTCACCATCACCGCCTGCGACACCACCGACCCCGAGGCCGTGCAC
CGCCTCGTCGCCTCCGTCGACGAGCAGCACCCGCTGACCGCCGTCATCCACACCCCCGGT
GTGCTCGACGACACGATCCTCACGCAGCTCACCCCGGAGACGCTGCACCCGGTCCTGGCG
CCGAAGGTCGACGCCGCGTACCACCTGCACCAGGCCACCCGGCACCTGGACCTCGCCCAC
TTCGTCCTCTACTCCTCCGCCGCGGGCACGCTGGGCAACCCGGGGCAGGCGAACTACGCC
GCCGCCAACACGTACTTGGACGCCCTCGCCCACCACCGCACCCGGCAGGGGCTCCCCACG
ACGAGCCTCGCCTGGGGCTACTGGAAGCACACGACGGACCTGACGAGCCACCTCGGTGAC
AGCGAGGTCGCCCGCAGCGACGCCGCGCTCAGCACCGAGCACGGCCTCCAGCTCCTCGAC
GCGGCCCTCGCCACCCCGTCCCCGTACCACCTCTGCGTCCCGCTGAACCCGGCCACGCTC
CGCACCGGCGACCGCGTCCCCGCCCTCCTGCGCGACCTCGCCCCGCGGGCACGCCGCCGG
GCGGCCGCCGCCGTCGCGGCGGGCGAGGTCTCGGGGCTCGCGCAGCAGCTCGCCGGGCTC
TCGGCCGCCGACCAGCAGCGCCTGCTGCTCGACCTGGTGCGCACCAACGCCGCCGCCGTC
CTGGGCCACAGCGACGCCGCGGCGGTGGACGCGCAGGCACCGTTCAACGACCTCGGGTTC
GACTCCCTCACCGCGGTCGAACTGCGCAACCGGCTCGACTCCGCCACCGGGCTGCGGCTG
CCGGCGACCCTGATCTTCGACTACCCGACCGCCCAGGTCCTCGCCGAGCACATCGGCGCC
GAACTGCTGGAGTCGGCGCCGCGCTCGGCGGCGCCGCAGCTCGTGAGCGCCGACGCCGCG
GACGACCCCGTCGTCATCGTGTCGATGGCGTGCCGCTTCCCCGGCGACGTCCGCTCGGCC
GCCGGGCTGTGGAAACTCGTCACCGAGGGCCGCGAAGGGGTCTCCGGCTTCCCGACGAAC
CGCGGCTGGGACCTCGACAACCTCTTCGACCCCGACCCGGCGGCGACGGGCAAGAGCTAC
ACCAGCTACGGCACGTTCCTGCACGAGGCCGACGAGTTCGACGCGGACTTCTTCCGCATG
AACCCGCGTGAGGCACTGGCCACGGACCCGCAGCAGCGGCTGCTGCTGGAGACCTCCTGG
GAGGCGTTCGAGCGGGCCGGCATCGACCCGGGCACGCTCAGGGGCAGCAGCACCGCGGTC
TACGCCGGCGTCATCTACGGCGACTACGGCTCGCGGCTGATGCAGAACGCCCCGGAGGGC
TTCGAGGGCTACCTCGGCAACGGCAGTGCCGCGAGCGTCGCCTCGGGGCGGGTCGCGTAC
ACCTTCGGGCTCGAGGGCCCGGCGGTGACGGTGGACACGGCGTGCTCGTCGTCGCTGGTC
GCGCTGCACCTCGCGGCGCAGGCGCTGCGCAACGGCGAGTGCGACCTCGCGCTCGCGGGC
GGCGTCACCGTCATGTCGAGCCCGGGGGCGTTCATCGAGTTCTCCCGGCAGCGCGTGCTG
TCGGTGGACGGCCGGTGCAAGGCGTTCGCCGAGGCGGCGGACGGCACGGGCTGGGGCGAG
GGCGTCGGCCTCGTACTGCTGGAGCGGCTGTCGGACGCGCAGCGCAACGGGCACACGGTG
CTGGCGGTGCTCAAGGGCTCCGCCATCAACCAGGACGGTGCCTCCAACGGCCTCACCGCC
CCCAACGGGCCCTCCCAGCAGCGCGTCATCGAGCAGGCGCTCGCCAGCGCCGGGCTGACG
CCCGGTCAGGTGGACGCCGTCGAGGCCCACGGCACGGGCACGGCGCTGGGCGACCCGATC
GAGGCGCAGGCACTGCTGGCCACGTACGGGCGCGAGCACAGCCCCGAGCGCCCGCTGTGG
CTGGGCTCCATCAAGTCCAACATCGGCCACACGCAGGCCGCGGCGGGCGTGGCGGGCGTC
ATCAAGATGGTCGAGGCCATGCGCCACGGCACACTGCCCCCCACCCTCCACGTGAACGAG
CCGTCCCAGCACGTCGACTGGAGCTCCGGCACCATCTCGCTGATCACGGAGTCGACTCCG
TGGCCCGAGAGCGACGAGCCGCACCGGGCGGCGGTGTCCTCGTTCGGCATCAGCGGCACG
AACGCGCACGTGGTGCTGGAAGCGGCACCGGTCGAGCCCGCGGCGGCGGAGCCGACTGCG
GAGCGGGTGCCGGACAAGAGCCGTGCCGCGCCGGTGCCGGTGGTGGTCTCCGCCCGCACG
GCGGATGCGCTGGCGCAGGCTGCGGGGCAGCTCGCGGAGTTCGTGGAGCGGCACCCGCAG
GTCGAGGTGGGTGCGCTGGCGTCGGGGCTGTGGTCCGGCCGGGCGAAGATGGAGCATCGC
GCAGGCGTGGTCACGGCCGACCGGGACGAGCTGCTGGAGGCCCTGACCGCGCTGGCCACC
GGTTCCGCGCACGCGGCGCTGGTCACGGGCCCGGGATCGGTGTCTGCAGGGAAGACCGCG
TTCGTGTTCCCGGGCCAGGGGTCGCAGTGGACCCGTATGGGCTACGAACTCGCCGCCCAG
GAACCGGCCTTCGCGGCGCACCTGGCATCGTGCCGGGACGAGCTGTCCCGCTGGTGCGAC
TGGGACCTCCTCGAGGTCCTCGCCAGCGAAGACGAGCATGCGCTCGACCGTGTTGACGTC
GTGCAGCCCGCGCTGTTCGCGGTGATGACGGGCATCGCCCAGCTTTTGCGCCACCACGGC
GTGGAGCCGGACGCGGTCATCGGCCACTCCCAGGGCGAGATCGCCGCCGCCTACGTCGCC
GGCGCGCTGACGCTCTCCGACGCCGTCGCCGTGGTGGCGCTGCGGGCGCAGGCCATCACC
CGCCTCGCCGGCACCGGGACCATGGCCTCCTTCCCCCTCCCCCAGGATGAGTTGGTTGAC
CTGCCCGAAGGCGTCTACGTGGCCGCGGTCAACGGACCGCACACCACCATCCTCGCCGGG
GAAACACAGCCCCTCGCCGACCTGGTCAACAACTACCAGGAGCGGGAGATCCGGGCGCGG
CTGATCCCCGTCGACTACGCCTCGCACACCCCGCACGTCGAAGACCTGCGGGAAACGATC
ATCACGGACCTGGCCGAGCGCGCCGGCATCGAGCCGATGCCGCCGACGATCCCGTTCTAC
TCCACCCACACGGGCGCCCTGCTCACCTTCGACCAGGACCTCGACGCGGAGTACTGGTTC
AACAACCTCCGCCACCCCGTCCACTTCCACACCACCCTCGAACAACTCCTCGACGACGGG
CACTACACCCTCATCGAGTCCAGCCCCCACCCCGTCATGACCGCCGCCCTGGCCGACACC
TTCGAACAGCGCGCCACCCCGGCCCGCCACTACGCGACCCTCGTCCGCAACGACGACACC
AAGGTGCGCTTCCTCACCGCGCTCACCACGCTCCACACCCACCACCACCCGATCGACCTC
ACCCCCCACCTCCCCGCCGCCGACCGGTCGGGCGACGGGCTTCCCGAGCTGCCCACGTAC
CCGTTCCAGCGGGAGAGCTACTGGCTCCACGGCTCCGCCCAGCTCACCAGCGCGTCCGAC
CTCGGCCTGGGCACCACCGCCCACCCGCTGCTGCACGCCGCCGTCCAACTCGCGGACGAG
GCGGGCACGGGCGCCGCCGGCGCTGTGGTGTTCACCGGCCGCGTCGGCCTGAGCACGCAC
TCCTGGCTCGCCGACCACGCGGTTGCGGGTACGGTCCTGCTGCCCGGCACGGCACTCGTG
GACCTCGCCCTGCACACCGGCGACCACACCGGCGCCACCCACCTCGAGGAGCTGACGCTC
CAGGCGCCGCTGGTGCTCCAGGAGTCCGGCGCCCGGGACCTCCAGGTCACCGCGAGCCCC
CACCCGGAGGCGGACGGCTGGCAGGTCACGATCCACTCCCGCCCCCACACCGACGACGAG
GCCGAGCCCGAGCCGTGGACCTGCCACGCCACCGGCACGCTCACCGCCGAACCGGCGGTG
AAGGCCGAGGCGCTGGACCAGTGGCCGCCTGCGGGCGCGCAGGCGCTCGACGTGTCCGAG
ATCTACCCCCGGCTGGCCGCGGGCGGCTACGAGTACGGGCCCGCCTTCCGCGGGGTCACC
GCGGCCTGGGCGCAGCCCGACGGCACGCTCCACGCCGAGATCGCCCTGCCCGAGGACACC
GACCCCGACGGGCACACGATCCACCCCGCCCTGCTCGACGCCGCCCTCCACCCGCTGGCG
GCCCACGGCGGCGCCGGGGGCAAGGCGGACGCGGCGGAGGACGCGCAGGTACGGCTGCCG
TTCGCGTGGACCGGTGTGTCCGTCCACGCCACCGGCGCCACCCACCTCCGCGCGACGATC
ACGCCCACCGGAGCCGAGGGCCACGACCTCGCGCTGCGCGCCTGGGATCCCACCGGCGCC
CCCGTCGCCACCATCGGTGCCCTCAACACCAGGGCCGTCGCCGCGTCGGCACTGACCGGC
GGTGCCGACGCCGGCGCCGCGACCCGCAACAGCCTCTTCCACCTGTCCTGGAGCCCCGCC
CAGGCGGAGCAGGAGGAGCAGGAGGAGCTGGACCGGTACGACGTCCACGTCGCCGCGCCC
GCCGCCGAGGACACCCCGGCCGCGGCCCACGCCGCGACCGAGGCGCTGCTCGTCCACGTA
CAGAACTGGCTGGCCGCGAACGACCAGACCGACCGGCTGCTCGCGGTCGTCACCCACCGG
GCCGTCGCCACCCACCCGGCCGAGGACGTCCACCTCGCCCACGCCCCGCTGTGGGGCCTG
CTCCGCAGCGCCCAGAGCGAGAACCCCGACCGCATCCACCTCGTGGACACCGACGCCACG
GGCATCGCCCCGGACGCCGACGCCGCCGACATCCCGTACCTCGCCGACGCACTCGCCACC
GGCGAGCCGCAGGTCGCCGTTCGCGGCGGTCAGGTGCTGGCCGCGCGCCTCGTGCGCGCG
GCGGGCGCGGAGAGCGGTGTGCTGGACGTGCCGGAGGGCACGTGGAAGCTGGGCAACGAG
GGCGACGGCACACTGGAGGCGCTCGCGTGCCGGCCCGCGCCCGAGTGGGACGTGCCGCTG
ACCGGCAGCCAGGTGCGCGTACAACTGCATGCGGTCGGCCTGAACTTCCGCGACACGCTC
ATCGCCCTGGGCATGTACCCCGGCGACGCCCCTCTCGGCAGCGAGGGTGCCGGCGTGGTG
ACCGAGATCGGCGCGGACGTCACGAACGTCGCGGTCGGCGACCGGGTCATGGGGCTCATG
CCCGAGGGCGCCGGCAGCCGGGCGATCACCGACCACCGCCTGCTCACGCCCGTTCCGGCG
GAGTGGTCCTCCACCCAGGCGGCGGGCACTCCGGTGGCGTTCCTCACCGCGTACTACGCG
CTGAAGGACCTGGGCCGGCTGGAGGCCGGCGAGTCGCTGCTCCTGCACGCCGCCACCGGC
GGCGTCGGCTCCGCCGCACTCCAACTCGCCCGCCACTGGGGCGCCGAGGTCTACGCCACG
GCAAGCCCGGGCAAGCACCACCTGCTCTACGCCCAGGGCCTGGACGATGCGCACATCGCG
TCCAGCCGGTCCCTGGACTTCGAGGAGCACTTCCGCACCCACGGCCCCGACCAGGGCGTG
GACGTGGTCCTCAACGCCCTCGCCCACGAGTTCACCGACGCCTCCCTGCGCCTCATGCGT
CCCGGCGGCCGGTTCATCGAGATGGGCAAGACCGACATCCGTGACCCGCAGGCGGTCGAG
GCCGAACACGGGGCCCTGTACCGGAACTTCGACCTCATCGAGGCCGGCCCGGACCGCATC
CGGCAGATCCTGGCCCATCTCACCGAGCTGTTCGCCGAAGGACACCTCACCCCGCTGCCG
ACGACCTCGTTCGACGTACGGCAGGCTCGCCAGGCGCTGCGCTACCTGAGCCAGGCCCGG
CACACCGGCAAGGTGATCCTGGACCTGCCGCGGGCGCTCGACCCGGACGGTACGGTCCTG
ATCACCGGCGGCACCGGCGTCCTCGCCGGCCTGACGGCCCGCCACCTGATCACCGAACAC
GGCGTACGCCACCTCCTCCTCGCCTCACGCAGCGGCCCCGACCACGCGGGCGCCGCAGCA
CTCAGCGAAGAACTCACCGCACTCGGCGCCCAGATCACCGTCACCGCCTGCGACGTCACC
GACCCCGACGCCGTACACGCCCTCGTCGACTCCGTCGACGAACACCACCCGCTCACGGCA
GTCATCCACACCGCGGGCGCCCTGAACGACGCCGTGCTGACCAAGATCACCCCGGCCGAC
CTGCACCCGGTCCTGGCGCCGAAGGTCGACGCCGCGTACCACCTGCACCAGGCCACCCGG
CACCTGCCGCTGGCCCGGTTCGTCGTCTACTCCTCGGCCGCCGGCACGCTCGGCAACCCC
GGCCAGGCCAACTACGCCGCCGCCAACACCTACCTCGACGCCCTCGCCCACCACCGCACC
CGGCAGGGCCTCCCCACCACCAGCCTCGCCTGGGGCTACTGGAAGCAGGCCACCGGACTC
ACCGCACACCTCACCGCCGACCAGCAGGGCCGCACCGGCACGGCGCTCACCACGGAACAC
GGCCTGCGGCTCTTCGACGTCGCGCTCCGGGACCGCCCCGAGTCGACGCTCGTCTGCATG
CCGATCGAGCCGGGCGGCCTGCGCCGCGCGGCGAAGGTGCCGGCACTGCTCCGCGACCTC
GTCCCGGCCACCGCGCGCCGCGCGACCGCCGCGGGCGCGAGCGCGGTGCGGCGCTCCGGC
CTGGCGGAGGAGCTGGCCGGGCTCGGCGAGGCCGAGCAGGACCGACTGGTGCTGGACCTG
ATCCGGAGCAACGTCGCGGCCGTCCTCGGCCACGCGCGCCCCGAGACCATCGACCCGCAG
CGCCCGTTCAAGGAGCTGGGCTTCGACTCCCTCACCGCCGTCGAACTCCGCAACCGCCTC
ACCAACGCCACCGCGCTCCAACTGCCGTCCACGCTGGTCTTCGACCACCCGACGCTCACC
GAGCTGTCGGTGTTCCTGCGGGGCAAGCTGCTGGACGAGCAGCCGCGGGTGCGCGCCGCG
AAGCAGGTCGCGACCGTCGTCGACGACGACCCGATCGCCATCGTCTCGATGGCCTGCCGC
TACCCCGGCGGGATGCGGCGTCCCGAGGACCTGTGGAAGCTGGTCTCCGAGGGCGTCGAG
GCGATCGGCGACCTGCCGGACGACCGGGGCTGGGACCTCGACGGCCTGTACGACCCGGAC
CCGGACGCGCCGGGCAAGATGTACACCCGCAAGGGCGCGTTCCTGTACGACGCCGGGCAG
TTCGACGCGGACTTCTTCCACATGAACCCGCGCGAGGCCCTCGCCACCGACCCGCAGCAG
CGGCTGCTGCTGGAGACCGCGTGGGAGGCGTTCGAACGGGCGGGCATCGACCCCACCAGC
CTCAAGGGCAGCAGCACCGGTGTGTTCGCGGGCGTCATCTCGCAGGACTACCTGATGCGC
ATGCACGACGCGCCGGACCACCTGGAGGGCTACTTCGCCACCGGCGGCTCCGCGAGCATC
GCCTCGGGGCGGGTCGCGTACACCTTCGGGCTCGAAGGCCCGGCGATGACGGTGGACACG
GCGTGCTCGTCGTCCCTCGTCGCCCTGCACCTCGCGGCTCAGGCGCTGCGCAACGGCGAG
TGCGACCTCGCCCTCGCCGGCGGCGCGACCATCATGGCCACCCCCGGCACCTTCCAGGTC
TTCTCCCGCCAGCGCGGCCTGGCCGCCGACGGCCGCTGCAAGCCCTTCGCCGACGCGGCG
GACGGCACCGGCTGGGGCGAAGGCGTCGGCCTGGTGCTGGTCGAGCGGCTGTCCGACGCG
CGGCGCAACGGACACGAGGTACTCGCCGTCGTCCGCGGCTCCGCCATCAACCAGGACGGC
GCGTCCAACGGCCTCACGGCGCCCAACGGCCCGTCGCAGCGTCGCGTCATCGAGCAGGCC
CTCGCCAACGCCGGGCTGAGCGGCGACCAGGTCCACGCCGTCGAGGGGCACGGCACGGGT
ACGACGCTGGGCGACCCGATCGAGGCGCAGGCCCTGCTGGAGACGTACGGCCAGGCGCAC
TCCGAAGAGAATCCGCTGTGGCTGGGCTCCATCAAGTCCAACATCGGGCACACGCAGGCC
GCGGCCGGTGTGGCGGGCGTCATCAAGATGGTCGAGGCCATGCGGCACGGTGTGCTGCCC
CCGACCCTCAACGTCGACGCGCCCACCAGCCATGTCGACTGGGCGGCGGGCCACATCGAG
CTGCTGACCGAGGCCCGTCCCTGGACCGAGGAGGCCGGACCGCGGCGCGCGGCGGTGTCG
TCGTTCGGCATGAGCGGCACCAACGCGCACCTGATCCTGGAAGCGGCCCCCGCCGAGGCG
GACGCCGAGGCCGAGCCGGAAGCCGGGGCCCCGCCGGTGCCGGTGGTGGTCTCCGCCCGT
TCGGCGGCGGCGCTGGCACAGTCGGCCGGCCGCCTCGCGGAGTACGTGGAGCAGCACCCG
GAGATCGAAGTGGGTCCGCTGGCCGCGCGGTTGTGGTCCGGTCGCGCGAAGATGGAGCAC
CGCGCGGGCGTCGTCACCGCCGACCGGGACGAACTGCTGGAGGCCCTGACCGCCCTGGCC
ACCGGTGCCGCGCACCCGGCGTTGGCCACCGGGCCGGGGTCCGCGGTCGCGGGCAAGACC
GCGTTCGTGTTCCCGGGGCAGGGTTCGCAGTGGACCCGTATGGGCTACGACCTCGCGGCT
GAAGAGCCCGCGTTCGCGGCGCACCTGGCCGCGTGCCGGGACGAGTTGTCACGTTGGTGC
GACTGGGACCTGCTGGAGGTCCTCGCCAGCGAGGACGAGGACGCGCTCGACCGTGTTGAC
GTCGTGCAGCCCGCGCTGTTCGCCGTCATGACGGGCATCGCCCAGTTGCTGCGCCACCAT
GGCGTGGAGCCGGACGCGGTCATCGGCCACTCCCAGGGCGAGATCGCCGCCGCGTACGTC
GCCGGCGCGCTCACCCTCTCCGACGCTGTCGCGGTGGTGGCGCTGCGGGCGCAGGCGATC
ACGCGCCTCGCCGGCACCGGGACCATGGCCTCCTTCCCCCTCCCCCAGGACGAACTGGGC
GACCTGCCCGAAGGCGTCTACGTGGCCGCGGTCAACGGACCGCACACCACCATCCTCGCC
GGAGAAACCCAGCCCCTCACCGACCTGGTCAACACGTACCAGGAACAGGAGATCCGCGCC
CGGCTGATCCCCGTCGACTACGCCTCGCACACCCCGCACGTCGAAGACCTGCGGGAAACG
ATCATCACTGATCTGACCGAGCGCGCCGCCATCGAACCGGTCCCGCCGACGATCCCGTTC
TACTCCACCCACACGGGCGCCGTGCTCACCTTCGACCAGGACCTCGACGCGGAGTACTGG
TTCAACAACCTCCGCCACCCCGTCCACTTCCACACCACCCTCGAACAACTCCTCGACGAC
GGCCACCACACGCTGATCGAGTCCAGCCCCCACCCCGTCATGACCGCCGCGCTGGCCGAC
ACCTTCGAGCAGCGCACGACGCCTGCCCACCACCACGCCACCCTCATCCGCAACAACGGC
ACCAAGGCCCGCTTCCTCACGGCACTCACCACCCTCCACACCCACCACCACCCCATCGAC
CTCACCCCCCACCTCCCGGCGGCGGGGAGCACGCCGGCGGGCCTCCCCACCTACCCGTTC
CAGCACCAGCCCTACTGGCTGAACACCCCCGCCCGACTCACCAGCGCCGGCGACCTGGGG
CTCGCCACGACGACGCACCCGCTGCTGCACGCCGCGGTCCAGCTCGCCGACGGCGCCGAC
GGCGGCGCGGGCACCACGGTGTTCACCGGCCGCGTCGGCCTGAGCACCCACCCCTGGCTC
GCCGACCACGCCGTCACCGGGACCGTGCTGCTGCCCGGCACCGGCCTGGTCGACCTCGCC
CTGCACGCGGGTGACCACACCGGCGCCACCCATCTCGAAGAGCTGACGCTCCAGGCGCCG
CTGGTGCTGGAGGAGACCGGCGCCCGCGACCTCCAGGTCACGGCCGCCCCCCAGGGCGGC
TCCGACGCCGGGGGTACGGGCCGGTGGCAGGTCACGATCCACTCCCGCCCGCACACCGGC
GACGCCGAACCCGAGCCGTGGACCTGCCACGCCACGGGCACGCTCACCGCCGAAGCCGCA
GAAGCCGCCGAGGCGCTGACCGAGTGGCCGCCCACGGGTGCGGAGGCCTTCGACGTCGGC
GCGCTCTACCCGGAGCTGGCCGCGGCGGGCTACGAGTACGGTCCCGTCTTCCAGGGCGTG
ACCGCGGCGTGGAAGGGATCCGACGGGACCCTGCACGCCGAGATCGCCCTCCCGCAGGGC
GCCGACGCGGCCGGCCACACCCTCCACCCGGCGCTCCTCGACGCCGCGTTGCACCCGCTC
GCGGCGCACAACGACGGCGCGGACGGGCAGATGCAGTTGCCGTTCGCGTGGACCGGCGTC
ACCGTGCACGCCACGGGCGCCACCGAGCTGCGCGCCACGCTCACCCCCACCGGCGAGCAG
GGCCACGACCTCGCTCTGCGGACGTGGGACACGACGGGCGCACCGGTGGCGACGATCACC
GCCCTCAACACCCGTCCCGTCGACGCCGCGGCGCTCAGCACCCGCAGCAGCGACGACACC
CGCAACAGCCTGTTCCACCTGGCGTGGAGCCCTGCACCGGCCGAGCCGGCGACTCAGGTC
GATCTGGACCAGGTCGACGTGTACGCGGCCGCCCCGGCGGAGGACGACTCCCCCGCCGCG
GCCCACACCGCAACCGAGGCACTGCTCACCCACCTCCAGAGCTGGCTGGCCGAGAACGAC
GAGACGGACCGACGGCTCGTCGTCCTCACCCACCGCGCCGTCGCCACCGACGCGGCCGAG
GACGTGCACCTGGCGCACGCGCCGCTGTGGGGCCTGGTCCGTACCGCCCAGAACGAACAG
CCCGACCGCATCCACCTCATCGACACCGACACGGACGACACCCCGGACCTCACCGCAGCC
CTCGCCACCGGCGAACCCCAACTCGCCCTCCGCAACGGCGACATCCTCATCCCCCGTCTC
ACCCGCTCCACCGACGACGCAGGGACCGAAGCCCGCCCCCTCAACCCAGACGGCACCGTC
CTGATCACCGGCGGCACCGGTGGCCTGGCGAGCCTCACCGCCCGCCACCTCATCACCGAA
CACGGCGTACGCCACCTTCTTCTGGCCTCACGCAGCGGCCCCGACCACCCCAACGCCCCC
GCCCTGAGCAGCGAACTCACCGAGCTGGGCGCCCAGGTCACCATCACCGCCTGCGACGTC
ACCGACGACGACGCCGTACGGGCCCTCGTCGACTCCATCGACGGGGACCACCCCCTCACC
GCCGTCATCCACACCGCGGGGGCCCTGGGCGACGCCGTCCTGTCGAAGCTCACTCCCGAC
GACCTGCACCCGGTGCTGGCGCCGAAGGTGGACGCCGCGTACCACCTCCACCAGGCCACC
AAACACCTGGACCTCGCCCACTTCGTCCTCTACTCCTCAGCCGCCGGCACGCTGGGCAAC
CCCGGCCAGGCCAACTACGCCGCAGCCAACACCTACCTCGACGCCCTCGCCCACCACCGC
ACCCGGCAGGGCCTCCCCACCACCAGCCTCGCCTGGGGCTACTGGGAGCAAGCCACCGGA
CTCACCGGCCACCTCACCGCGAGCCAGCAGAACCGCACCGGCACTCCGCTCACCACGGAC
CACGCCCTCCACCTCCTCGACACCGCCCTCACCACTCCCCAGCCCCACCACCTCTGCACC
CCGCTCAACCCCAGCACCCTCCGCACCACACCCCACCTCCCCGCGCTCCTCCGCGACCTC
GTCCACCGCCCCGTCCGCCGCACCGCGGCGGCCTCGGCTCCGGGCGTGCCCGGCGGGACC
GCGCTGGCCGACCAGCTCGCGGCGCTGCCGGAGCCGGAGCAGCGGCACAAGGTCGTCCTG
GACGTCGTACGGAGCAACATCGCCGCCGTGCTCGGCCACGGCACCGCCGACACCATCGAC
CCCCACCGCCCCTTCAAAGAACTCGGCTTCGACTCCCTCACCGCCGTCCAACTCCGCAAC
CAACTCACCACCACCACCGCACTACGCCTCCCCGCAACCCTGATCTTCGACCACCCCACC
CCCGACGCGATGGCCGCCCGGATCCTGGCGGACCTGATGCCGGAGGCGGTCAGCCCGTCG
CGGCGGGTGATCGCCGATCTGGACGCGCTGGAGCTGGAGTTGAAGCAGCTGGCGGCGGAC
GAGGCGGAGCGATCGCGGATCACGCTGCGGCTGCAGACGCTGCTGTCGAACTGGAACGAC
GCGCGGCCGGTCCCGGCCGAGGACGTGAGCAACAAGATCCAGGAGTCGTCCACGGAGGAG
ATCTTCGACTTCATCGACCGGCAGCTCGGTCGTACGGACGGAGACGAGGCGCCTTCGGCG
CCCGCCCGGTGA
[9] KS34..411
[9] AT569..866
[9] malonyl-CoA761..765
[9] DH931..1111
[9] ER1417..1721
[9] KR1731..1911
[9] ACP2009..2079
[10] KS2102..2478
[10] AT2641..2955
[10] methylmalonyl-CoA2826..2830
[10] DH3008..3179
[10] ER3483..3787
[10] KR3797..3977
[10] ACP4077..4147
[11] KS4170..4546
[11] AT4702..5016
[11] methylmalonyl-CoA4887..4891
[11] DH5066..5240
[11] KR5518..5698
[11] ACP5799..5869
[9] KS100..1233
[9] AT1705..2598
[9] malonyl-CoA2281..2295
[9] DH2791..3333
[9] ER4249..5163
[9] KR5191..5733
[9] ACP6025..6237
[10] KS6304..7434
[10] AT7921..8865
[10] methylmalonyl-CoA8476..8490
[10] DH9022..9537
[10] ER10447..11361
[10] KR11389..11931
[10] ACP12229..12441
[11] KS12508..13638
[11] AT14104..15048
[11] methylmalonyl-CoA14659..14673
[11] DH15196..15720
[11] KR16552..17094
[11] ACP17395..17607

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-694]  G3DSA:3.40.366.10 [761-852]  G3DSA:3.40.366.10 [2635-2762]  G3DSA:3.40.366.10 [2826-2947]  G3DSA:3.40.366.10 [4697-4823]  G3DSA:3.40.366.10 [4887-5008]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2037-2052]  PS00012 [4105-4120]  PS00012 [5827-5842]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2007-2082]  5.90000000000008e-66 G3DSA:1.10.1200.10 [4077-4150]  5.90000000000008e-66 G3DSA:1.10.1200.10 [5798-5871]  5.90000000000008e-66 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2002-2118]  1.20000117458134e-26 SSF47336 [4070-4186]  7.49999605851445e-27 SSF47336 [5790-5876]  3.0999994589937e-21 SSF47336
SSF47336   ACP_like
 [2009-2079]  PS50075 [4077-4147]  PS50075 [5799-5869]  PS50075
PS50075   ACP_DOMAIN
 [2012-2078]  1.5e-11 PF00550 [4080-4143]  2.4e-12 PF00550 [5802-5868]  7.30000000000002e-12 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1403-1551]  5.29999657550189e-27 SSF50129 [3471-3617]  7.19999557654549e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1555-1650]  9.40000000000003e-15 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1436-1493]  5.60000000000001e-06 PF08240 [3504-3558]  8.40000000000001e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1731-1910]  1.80000000000002e-63 PF08659 [3797-3976]  7.60000000000006e-63 PF08659 [5518-5697]  5.79999999999997e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-285]  1e-96 PF00109 [2102-2353]  2.39999999999997e-94 PF00109 [4170-4420]  1.5e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.40000000000001e-46 PF02801 [2361-2478]  1.29999999999998e-48 PF02801 [4428-4546]  1e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-866]  4.5e-55 PF00698 [2641-2955]  2.39999999999997e-89 PF00698 [4702-5016]  3.10000000000005e-89 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.2e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [564-875]  3.59998852907783e-57 SSF52151 [2638-2939]  7.40000780398351e-65 SSF52151 [4699-5000]  1.19999063421924e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-760]  3.7999986264479e-13 SSF55048 [2764-2825]  1.20000117458134e-11 SSF55048 [4825-4886]  2.59999946718995e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [297-464]  G3DSA:3.40.47.10 [2104-2365]  G3DSA:3.40.47.10 [2366-2530]  G3DSA:3.40.47.10 [4172-4432]  G3DSA:3.40.47.10 [4433-4599]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-463]  1e-102 SSF53901 [2094-2528]  2.50000909916183e-101 SSF53901 [4162-4598]  6.59996953923913e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1507-1694]  1.20000000000001e-96 G3DSA:3.40.50.720 [1731-1919]  8.49999999999995e-116 G3DSA:3.40.50.720 [3574-3762]  1.20000000000001e-96 G3DSA:3.40.50.720 [3797-3980]  2.39999999999997e-113 G3DSA:3.40.50.720 [5518-5701]  2.39999999999997e-113 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [2266-2282]  PS00606 [4333-4349]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [568-881]  6.29998179434741e-85 SM00827 [2642-2938]  5.60004908290974e-94 SM00827 [4703-4999]  2.59998233910302e-94 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2010-2082]  7.79998304125571e-33 SM00823 [4078-4150]  2.10000267834031e-32 SM00823 [5800-5872]  1.79999754022375e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [931-1111]  2.2999842048857e-73 SM00826 [3008-3179]  5.39997012872478e-74 SM00826 [5066-5240]  7.6999848053369e-74 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825 [2104-2531]  SM00825 [4172-4598]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1731-1911]  1.90000694315261e-65 SM00822 [3797-3977]  4.69998262513195e-62 SM00822 [5518-5698]  3.49999466863949e-64 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1417-1721]  SM00829 [3483-3787]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit